KEGG   Haliangium ochraceum: Hoch_5049Help
Entry
Hoch_5049         CDS       T01103                                 

Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hoh  Haliangium ochraceum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hoh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hoch_5049
   00030 Pentose phosphate pathway
    Hoch_5049
   00051 Fructose and mannose metabolism
    Hoch_5049
   00052 Galactose metabolism
    Hoch_5049
   00500 Starch and sucrose metabolism
    Hoch_5049
   00520 Amino sugar and nucleotide sugar metabolism
    Hoch_5049
  Nucleotide metabolism
   00230 Purine metabolism
    Hoch_5049
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Hoch_5049
Enzymes [BR:hoh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Hoch_5049
    5.4.2.8  phosphomannomutase
     Hoch_5049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6966178..6967617
Genome map
AA seq 479 aa AA seqDB search
MNPSVFREYDIRGVAERDLGGDFARLLGRAMGQRLHAVRSPALAAEARPRLVVGRDCRVS
SPRLARALIAGARAVGVDVIELGVVPTPVFYYAVHALAPEGGVQVTGSHNPARDNGFKLI
CAGERLHGPAIQELRAAMELAEAQGQPGGAAAPEPGQCTTHDATAAYLRMSAASLRMGPR
RCKLVLDAANGAGGPTALALFRQLGFEVEPLYCEMDGRFPNHSPDPLVPANLVDLRQRVR
DTGAELGIALDGDADRIAAVDARDRVMWGDQLMILLGQALLREHPGCDIVAEVKCSQALF
DLLAAAGGVVHMGRAGHALVKAKMRETGALLGGELSGHLFFADRHPGYDDGIYAGARLLE
LLSHAPTTLAEHCDSLPAMVNTPELRLACPDEAKFAVVAAAGARLRARDDIRGVVEIDGT
RVTFADGWGLVRASNTEPALVLRCEASSHERLSAIRTLLEETVAAAMDDAGAPTPGTTP
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgaaccccagcgtctttcgcgaatacgatatccgcggcgtggccgagcgcgacctcggc
ggcgacttcgcccggctgctgggtcgcgccatgggccagcgcttgcacgccgtacgcagc
cccgcgctcgccgctgaggcccggccgcggctggtggtcgggcgcgactgccgggtgtcc
tcgccgcgcctggcgcgcgcgctgatcgcgggggcgcgcgcggtcggcgtcgacgtcatc
gagctgggcgtggtgccgacgccggtcttctattacgcggtgcacgcgctggcgcccgag
ggcggcgtacaggtcaccggcagccacaacccggcccgcgacaacggcttcaagctgatc
tgcgccggcgagcgcctgcacggcccggccatccaggagctgcgcgcggccatggagctg
gccgaggcccagggtcagcccggcggcgccgcggcgccagagcccgggcagtgcacgacc
cacgacgccaccgcggcctatctgcgcatgtccgcggccagtctgcgcatgggcccgcgc
cgctgcaagctggtgctcgacgcggccaacggcgccggcggccccaccgcgctggccctg
tttcgccagctcggcttcgaggtcgagccgctgtactgcgagatggacgggcgcttcccc
aaccactcgccggatcccctggtgcccgccaacctggtcgacctgcgccagcgcgtgcgc
gacaccggcgccgagctcggcatcgcgctcgacggcgacgccgaccgcatcgcggccgtg
gacgcgcgcgaccgggtaatgtggggcgaccagctcatgatcctgctcggccaggcgctc
ctgcgcgagcacccgggctgcgacatcgtggccgaggtcaaatgctcgcaggcgctcttc
gatctgctcgccgccgccggcggcgtggtgcacatgggccgcgccggccacgccctggtc
aaggccaagatgcgcgagaccggcgccctgctcggcggcgagctcagcggtcacctgttc
tttgccgaccgccaccccggctacgatgacggcatctacgccggcgcgcggctgctcgag
cttctctcgcacgcgcctaccacgctcgccgagcactgcgatagtctgccggccatggtc
aacacgcccgagctgcgcctggcctgccccgacgaggccaagttcgccgtggtcgcggcc
gccggtgcgcgtctgcgcgcgcgcgatgacatccgcggcgtggtcgagatcgacggcacc
cgcgtgacctttgccgacggctgggggctggtgcgggcgtcgaacaccgagccggccctg
gtgctgcgctgcgaggccagctcgcacgagcgcctgagcgccatccgcacgctcctcgaa
gagaccgtggccgcggccatggacgacgccggcgcccccactccaggaacaacgccatga

DBGET integrated database retrieval system