KEGG   Haliangium ochraceum: Hoch_5050Help
Entry
Hoch_5050         CDS       T01103                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
hoh  Haliangium ochraceum
Pathway
hoh00010  Glycolysis / Gluconeogenesis
hoh00052  Galactose metabolism
hoh00500  Starch and sucrose metabolism
hoh00520  Amino sugar and nucleotide sugar metabolism
hoh00521  Streptomycin biosynthesis
hoh01100  Metabolic pathways
hoh01110  Biosynthesis of secondary metabolites
hoh01120  Microbial metabolism in diverse environments
hoh01130  Biosynthesis of antibiotics
hoh01200  Carbon metabolism
Module
hoh_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:hoh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hoch_5050
   00052 Galactose metabolism
    Hoch_5050
   00500 Starch and sucrose metabolism
    Hoch_5050
   00520 Amino sugar and nucleotide sugar metabolism
    Hoch_5050
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Hoch_5050
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Hoch_5050
Enzymes [BR:hoh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Hoch_5050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ACY17538
UniProt: D0LVH7
Position
6967614..6968693
Genome map
AA seq 359 aa AA seqDB search
MSTDTPAIPPSPAHAAAHAPHTDWVVGVDLGGTNMRLALYRDHLQAHARLLGDDAAASAP
APVYTHRETVGEERGALAVATRMAAAIERLVAEAGIADPRIPVGVGVAGMLRGFDGLVAN
APNLAWRDEPFGAMLADALGPRFPVGVYNDVNAITYGEYAFGSGIGARDVLAVFIGTGIG
GGVVTNGQMVEGTSNCAGEVGHFKIDLSPEAPMCGCGGRGCIEAFAGGGNLQARLRRELA
RGPASLATELAGGADKVTPGHIDQAAEKDDAYALAIYEQLVPMIAVSLANTVFALNPGRL
ILGGGLLMRTPLLRRRIIERIPSFLTPAQSEPLEIVETLLGEEAGLLGSALLAAQRLGQ
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagatacccccgcgattccacccagcccggcgcacgccgcggcgcacgcgccg
cacaccgattgggtggtcggcgtcgacctcggcggcaccaacatgcgcctggccctgtac
cgcgaccacctgcaagcgcacgcgcgcctgctcggtgacgacgcggccgcgtcggcgccc
gcgcccgtgtacacgcaccgcgagaccgtgggcgaggagcgcggcgccctggccgtggcc
acgcgcatggcggccgcgatcgagcgcctggtggccgaggccgggatcgcagacccgcgc
atcccggtgggcgtgggcgtggccggtatgctgcgcggcttcgacgggctggtggccaac
gcgcccaacctggcctggcgcgacgaacccttcggcgcgatgctcgccgacgcgctcggc
ccgcgcttcccggtcggcgtgtacaacgacgtcaacgccatcacctacggcgagtacgcg
ttcggctccggtatcggcgcgcgcgacgtgctggccgtgttcatcggcaccggcatcggc
ggcggcgtggtcaccaacggccagatggtcgagggcaccagcaactgcgccggcgaggtc
gggcacttcaagatcgacctgtcgcccgaggcgcccatgtgcggctgcggcggtcgcggc
tgcatcgaggcctttgccggcggcggcaacctgcaggcccgcctgcgccgcgagctggcc
cggggcccggcgtcgctggcgaccgagctggccggcggcgccgacaaggtcacgcccggg
catatcgaccaggcggccgaaaaagacgacgcctacgccttggccatctacgagcagctc
gtgcccatgatcgcggtgagcctggccaacaccgtgttcgcgctcaaccccgggcgcctg
atcctcggcggcggtctgctcatgcgcacgccgctcttgcgccggcggatcatcgaacgc
atcccgagcttcctcacgccggcgcagagcgagccgctcgagatcgtcgagaccctgctc
ggcgaagaggccggcctgctcggcagcgcgctgctggccgcccagcgcctgggccagtag

DBGET integrated database retrieval system