KEGG   Haliangium ochraceum: Hoch_5127Help
Entry
Hoch_5127         CDS       T01103                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hoh  Haliangium ochraceum
Pathway
hoh00260  Glycine, serine and threonine metabolism
hoh00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hoh01100  Metabolic pathways
hoh01110  Biosynthesis of secondary metabolites
hoh01130  Biosynthesis of antibiotics
hoh01230  Biosynthesis of amino acids
Module
hoh_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hoh00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hoch_5127
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Hoch_5127
Enzymes [BR:hoh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Hoch_5127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACY17615
UniProt: D0LWG5
Position
7065277..7066521
Genome map
AA seq 414 aa AA seqDB search
MNQLLQAKNGYFGEFGGKFIPEILHEVFAELEAAFEAIRDDASFWSEFDHHLRTYSCRPT
PLTHASNLSAHFGGAQVYVKREDLNHTGAHKFNNVLGQALLAVRMGKKRIIAETGAGQHG
MATATIAAKFGLECVIYMGEVDVARQRPNVFWMEKLGAKVVPVSDGTRTLKDAVNAAFKD
WVTHAGDTHYLLGTACGPHPFPEMVARFQRIIGDEARAQILEAHGALPRRVYACVGGGSN
ALGLFQGFLDDEAVELIGVEAGGHGLDSGEHAARLAGSDATVGIAQGYKTFFIQSSDGQM
RDTHSIAAGLDYVGVSPILAHLGQQGRVRFAAATDEQVMAAHALVVKREGIIPALESTHA
FAHAFAELPDTSPEDAVVINQSGRGDKDIFTIADAYGDRAWEEFVCSKAEQYRK
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaattactacaggcaaaaaacggatacttcggtgaattcggcggcaagttcatc
cccgaaatcctgcacgaggtattcgccgagctcgaggcggccttcgaggccatccgcgat
gacgcgtcgttctggagcgagttcgaccaccacctgcgcacctactcgtgccggccgacc
ccgctcacccacgccagcaacctgagcgcgcatttcggcggcgcccaggtctatgtcaag
cgcgaggacctcaaccacaccggcgcgcacaagttcaacaacgtcctgggccaggcgctg
ttggccgtacgcatgggcaaaaagcgcatcatcgccgagaccggcgccggccagcacggc
atggccacggccaccatcgcggccaaattcggcctcgagtgcgtcatttatatgggcgag
gtggatgtcgcccggcagcggcccaacgtgttctggatggagaagctcggcgccaaggtc
gtgcccgtgagcgacggcacccgcacgctcaaagacgcggtcaacgccgcgttcaaagac
tgggtgacccacgccggcgacacccactacctgctgggcacggcctgcggcccccacccc
ttccccgagatggtcgcgcgctttcagcgcatcatcggcgacgaggcccgcgcccagatc
ctcgaggcccacggcgcgctgccgcgtcgggtgtacgcctgcgtcggcggcggctcgaac
gcgctcggcctgttccagggctttctcgacgacgaggcggtcgagctgatcggcgtcgag
gccggcggccacggcctcgacagcggcgagcacgcggcgcggctggccggcagcgacgcc
accgtgggcatcgcccagggctacaagacttttttcatccagtcgtccgacgggcagatg
cgcgacacccactcgatcgcagccgggctcgactacgtcggcgtctcgcccatcctcgcg
catctcggccagcagggtcgggtgcgcttcgcggccgccaccgacgagcaggtcatggcc
gcgcacgccctggtggtcaaacgagagggcatcatcccggcgctggaatcgacgcacgcc
ttcgcccacgcctttgccgagttgcccgacaccagccccgaggacgcggtggtgatcaac
caatcgggccgcggcgacaaagacatattcaccatcgccgacgcctacggcgaccgcgcc
tgggaggagttcgtatgcagcaaagcggagcagtaccggaaatga

DBGET integrated database retrieval system