KEGG   Haliangium ochraceum: Hoch_5128Help
Entry
Hoch_5128         CDS       T01103                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hoh  Haliangium ochraceum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hoh00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hoch_5128
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Hoch_5128
Enzymes [BR:hoh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Hoch_5128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
7066551..7067330
Genome map
AA seq 259 aa AA seqDB search
MPTTKLEERVRARRQQREILLISHAVLGYPSFDTCEAAIDEMMARGVDIVELQVPFSDPQ
ADGPFFTHANQVAVDGGTSVDACFDFAAATCARHPEGNFVIMTYFNILYQYGVSAFVERA
AAAGVQGFIIPDLPVEEADEYVAACDAHGLAPIFLFTPATSPERMREVARHTRGFVYCQA
RFGVTGNHTEFDDAVDAYIERCRAATALPIAMGFGIQTRADVDFLRGKIDIAICCTQAVR
VMTEQGVPAMGGFLAGLRD
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
gtgccgacgaccaaactcgaggagcgcgtgcgcgcgcgccgtcagcagcgcgagattctg
ctgatctcgcacgcggtgctcggctacccgtccttcgacacctgcgaggccgcgatcgac
gagatgatggcccgcggcgtcgatatcgtcgagttgcaggttccgttctcggatccccag
gccgacggtcccttcttcacccacgccaaccaggtcgccgtcgacggcggcacctcggtg
gacgcctgcttcgacttcgcagccgcgacctgcgcgcgtcaccccgagggcaacttcgtc
atcatgacgtatttcaacatcctgtaccaatacggcgtcagcgcgtttgtcgagcgcgcg
gcggccgccggcgtgcagggcttcatcattcccgacctaccggtcgaagaagccgacgag
tacgtggccgcctgcgacgcccacggcctcgcgccgatcttcttgttcacaccggcgact
tcgcccgagcgcatgcgcgaggtcgcgcgccacacccgcggcttcgtgtactgccaggcg
cgctttggcgtcaccggcaatcacaccgaattcgacgacgccgtggacgcctacatcgag
cgctgccgggcggcgaccgcgctgcccatcgccatgggcttcggcatccagacccgcgca
gacgtggacttcttgcgcggcaagatcgacatcgccatctgctgcacccaggccgtgcgc
gtgatgaccgagcagggcgtcccggccatgggcgggttcctggccggactgcgcgactga

DBGET integrated database retrieval system