KEGG   Haliangium ochraceum: Hoch_5137Help
Entry
Hoch_5137         CDS       T01103                                 

Definition
exodeoxyribonuclease V (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
hoh  Haliangium ochraceum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hoh00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Hoch_5137
Enzymes [BR:hoh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Hoch_5137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7075721..7077970
Genome map
AA seq 749 aa AA seqDB search
MKRSWLQISPRGTARERYEQRVGLAPLASAAAAETSADSDAAAASEAERDAGERERLASF
FRNVAAGAHAHDLGDESLYLAEELAELQWSLAGRHKRAVALLALATMISARQGSSRLPID
LAPDGYLARLLGSLLSAGEMQLAPAEVLRDIEALPRLPALDKVIGRPGEYRPLIFSDGCI
YQHRMLWCEDQLAARLRERLGGARDDTSMAGRAAPRTTAGTAAGAAGDSAGAVAGDAASE
DAASAALAAVLARPAMVGADAVVLSDEQAAAVRAATRQRFCVISGGPGTGKTAIVVTILR
TLARLGESPESALLAAPTGKAANRMGSSIRSALLAVPDPDPVDRQLLERASEPQTLHRLL
GYVPVLDRFRQHENNPLRARTVIVDEASMIDAELMERLLRAVPSETRLVLLGDADQLPSV
DAGAVLRDLVAAGTGDDGGFARRLTHSYRMDVRDPAGRAILGAAQAMNRGETALALPIRR
AAKELQWHGIELLDTVGATGATEGTTAPAADIAAVNDFVDHWYDKRIASDREFARLSTKT
FQRHDDAFTPEDAADLRALMSIYERSRLLTVTRRYDTGAEAINRRLHRRVITAASVDYGP
DFYPGEPVMMRRNDYERGLFNGDQGVVVRVSENGEPQRFRLAFARGEEFAVFSLDALRMH
VELAFAMTVHKSQGSEFSEVALVLPLEAIPLATREMLYTGVTRARRAVVLVGAPALLRTA
IAQRGERFSGLADKLAPAPDGAAYAEVRG
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgttcctggttacagatctcgccgcggggcaccgcgcgcgagcgctacgagcag
cgcgtgggtctggcgccgctggcgtcggccgcggctgccgagacgagtgccgatagcgac
gccgccgcagcgagcgaagccgagcgcgacgccggcgagcgcgagcgcctggcgagcttc
ttccgcaatgtcgccgcgggcgcccacgcccacgatctcggcgacgagagcctgtatctg
gccgaggagctggccgagctgcagtggtcgctggccggccgtcacaaacgggcggtggcg
ctgctcgcgctggcgaccatgatcagcgcgcgccagggctccagccggctgcccatcgac
ctcgcccccgacggctatctcgcgcgcctgctgggctcgctgctcagcgccggcgagatg
cagctcgcgcccgccgaggtgctgcgcgatatcgaggccctgccgcggctgcccgcgctc
gacaaggtgatcggacgaccgggcgaataccggccgctgatcttcagcgacggctgcatc
taccagcaccgcatgctgtggtgcgaggaccagctcgccgcgcggctgcgcgaacggctg
ggcggcgcgcgcgacgacacatcgatggccggccgggcggcgcccaggacgacagcgggg
acagcagccggcgcggcgggcgacagcgcgggcgcggtggccggcgacgcagcgagcgag
gacgcggcgtcggccgcgctcgcggccgtgctcgcccgcccggccatggtcggcgcggat
gccgtcgtgctgtccgacgaacaggcggccgcggtgcgcgcggccacccggcagcgcttc
tgcgtcatctccggcggccccggcaccggcaagaccgccatcgtggtgaccatcctgcgc
accctcgcgcgtctgggcgaatcgcccgagagcgcgctcctggccgcgcccacgggcaaa
gccgccaaccgcatgggcagctcgatccgctcggcgctgctggcggtgcccgaccccgac
ccggtcgatcgccagctcctcgagcgcgccagcgagccgcagaccctgcaccgcctgctc
ggctacgtgccggtcctcgatcgctttcgccagcacgagaacaacccgctgcgggcgcgc
acggtcatcgtcgacgaggcgtccatgatcgacgccgagttgatggagcgcctgctgcgc
gcggtgccgtccgagacccgcctggtgctgctcggcgacgccgaccagttgccctcggtc
gacgccggcgcggtgctgcgcgatctggtcgccgcgggcacgggtgacgacggcggcttt
gcccgcaggctcacccacagctatcgcatggacgtgcgcgaccccgccggccgcgccatc
ctcggcgccgcccaggccatgaaccgcggcgagaccgcgctggccctgcccatccgacgc
gcggccaaggagctacagtggcacggcatcgagctgctcgataccgtcggcgccaccggc
gccaccgagggcacgacagcccccgccgccgacatcgccgcggtcaacgactttgtcgac
cactggtacgacaaacgcatcgccagcgaccgcgaattcgcgcgcctcagcaccaagacc
ttccagcgccacgacgacgcctttacacccgaggacgccgccgatctgcgcgcgctgatg
agtatctacgagcgcagccggctgctcaccgtgacccgccgctacgacaccggcgccgag
gccatcaaccgccgcctgcaccgccgcgtcatcaccgcggcctcggtcgactacggcccc
gacttctaccccggcgagccggtgatgatgcgccgcaacgactacgagcgcggcctgttc
aacggcgaccagggcgtggtcgtgcgcgtgtccgaaaacggcgagccgcagcgcttccgc
ctggcctttgcgcgcggcgaggagttcgccgtgttctcgctcgacgccctgcgcatgcac
gtcgagctggcgttcgcgatgacggttcacaagagtcagggctcggagttctccgaggtc
gccctggtgctgccgctcgaggccatcccgctggcgacgcgcgagatgctgtacacgggc
gtcacccgcgcccgccgcgccgtggtcctggtgggcgcgcccgcgctgctgcgcacggcc
atcgcccagcgcggcgagcgcttctcggggctggccgacaagctcgcgcccgcgcccgat
ggcgccgcctacgccgaggtccgcggatga

DBGET integrated database retrieval system