KEGG   Haliangium ochraceum: Hoch_5147Help
Entry
Hoch_5147         CDS       T01103                                 

Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
hoh  Haliangium ochraceum
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hoh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hoch_5147
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Hoch_5147
   00640 Propanoate metabolism
    Hoch_5147
   00660 C5-Branched dibasic acid metabolism
    Hoch_5147
Enzymes [BR:hoh01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Hoch_5147
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7087863..7089035
Genome map
AA seq 390 aa AA seqDB search
MKIHEYQGKELLKRYGVPVPFGIAATSVEDAIAAVPKVQKEAGTDVVVVKAQIHAGGRGK
GGGVKVCKNAEAAEKAINDIYGMQLVTHQTGPEGKKVQRLLVEQGLDIAHEYYLGLTLDR
ASGRITVMASTEGGMEIEEVAERTPEKILKATINPAVGWQDYQARSLGFALGLDAKQVRA
LSSFLQALTKAYWEMDCSLLEINPLVTTNDGRVLALDAKVNFDDNALYRHKDLEDWRDLS
EEDPAETEAKKYDLSFIKLDGNIGCMVNGAGLAMSTMDIIKHYGGEPANFLDVGGGATAE
KVTAAFKIITSDPSVKSIFINIFGGIMKCDTIANGVVTAVKEVGLKVPLVVRLEGTNVDL
GKKILEESGLNLVAAADMADGAKKAVEHAK
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcacgagtatcaaggcaaagagctactcaagcgctacggcgtgccggttccc
ttcggcatcgccgccaccagcgtcgaagacgcgatcgcggcggtgcccaaggtccagaaa
gaggccggcaccgacgtggtcgtcgtcaaagcccagatccatgccggtgggcgtggcaag
ggcggcggcgtcaaggtgtgcaagaacgccgaagccgctgagaaggccatcaacgacatc
tacggcatgcagctagtcacgcaccagaccgggcccgagggcaagaaggtgcagcggctg
ctggtcgagcagggcctcgacatcgcccacgaatactacctcggcctcacgctcgaccgc
gcctcggggcgcatcacggtcatggcgtccaccgagggcggcatggagatcgaagaggtc
gccgagcgcacgcccgagaagatcctcaaggccaccatcaacccggcggtcggctggcag
gactaccaggcgcgcagcctgggcttcgccctgggcctcgacgccaagcaggtgcgcgcg
ctgtcctcgttcctgcaggcgctcaccaaggcgtactgggagatggactgctcgctgctc
gagatcaacccgctggtcaccaccaacgacggccgcgtgctggcgctcgacgccaaggtc
aacttcgacgacaacgccctgtaccggcacaaggatctcgaggactggcgcgacctgtcc
gaagaagacccggccgagaccgaggccaagaagtacgacctctcgttcatcaagctcgat
ggcaacatcggctgcatggtcaacggcgccggcctggcgatgtcgaccatggacatcatc
aagcactacggcggcgagcccgccaacttcctcgacgtaggcggcggcgccacggccgag
aaggtgaccgcggcgttcaagatcatcaccagtgatccgagcgtgaagagcatcttcatc
aacatcttcggcggcatcatgaagtgcgacaccatcgccaacggcgtggtcaccgcggtc
aaagaagtgggcctcaaggtgccgctggtcgtccggctcgagggcacgaacgtcgacctc
ggcaagaagatcctcgaagagagtggactcaacctggtcgcggcggccgatatggccgac
ggcgccaagaaagctgtggagcacgccaaatga

DBGET integrated database retrieval system