KEGG   Haliangium ochraceum: Hoch_5147Help
Entry
Hoch_5147         CDS       T01103                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
hoh  Haliangium ochraceum
Pathway
hoh00020  Citrate cycle (TCA cycle)
hoh00640  Propanoate metabolism
hoh00660  C5-Branched dibasic acid metabolism
hoh01100  Metabolic pathways
hoh01110  Biosynthesis of secondary metabolites
hoh01120  Microbial metabolism in diverse environments
hoh01130  Biosynthesis of antibiotics
hoh01200  Carbon metabolism
Module
hoh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hoh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hoh00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Hoch_5147
   00640 Propanoate metabolism
    Hoch_5147
   00660 C5-Branched dibasic acid metabolism
    Hoch_5147
Enzymes [BR:hoh01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Hoch_5147
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ACY17635
UniProt: D0LWI5
Position
7087863..7089035
Genome map
AA seq 390 aa AA seqDB search
MKIHEYQGKELLKRYGVPVPFGIAATSVEDAIAAVPKVQKEAGTDVVVVKAQIHAGGRGK
GGGVKVCKNAEAAEKAINDIYGMQLVTHQTGPEGKKVQRLLVEQGLDIAHEYYLGLTLDR
ASGRITVMASTEGGMEIEEVAERTPEKILKATINPAVGWQDYQARSLGFALGLDAKQVRA
LSSFLQALTKAYWEMDCSLLEINPLVTTNDGRVLALDAKVNFDDNALYRHKDLEDWRDLS
EEDPAETEAKKYDLSFIKLDGNIGCMVNGAGLAMSTMDIIKHYGGEPANFLDVGGGATAE
KVTAAFKIITSDPSVKSIFINIFGGIMKCDTIANGVVTAVKEVGLKVPLVVRLEGTNVDL
GKKILEESGLNLVAAADMADGAKKAVEHAK
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcacgagtatcaaggcaaagagctactcaagcgctacggcgtgccggttccc
ttcggcatcgccgccaccagcgtcgaagacgcgatcgcggcggtgcccaaggtccagaaa
gaggccggcaccgacgtggtcgtcgtcaaagcccagatccatgccggtgggcgtggcaag
ggcggcggcgtcaaggtgtgcaagaacgccgaagccgctgagaaggccatcaacgacatc
tacggcatgcagctagtcacgcaccagaccgggcccgagggcaagaaggtgcagcggctg
ctggtcgagcagggcctcgacatcgcccacgaatactacctcggcctcacgctcgaccgc
gcctcggggcgcatcacggtcatggcgtccaccgagggcggcatggagatcgaagaggtc
gccgagcgcacgcccgagaagatcctcaaggccaccatcaacccggcggtcggctggcag
gactaccaggcgcgcagcctgggcttcgccctgggcctcgacgccaagcaggtgcgcgcg
ctgtcctcgttcctgcaggcgctcaccaaggcgtactgggagatggactgctcgctgctc
gagatcaacccgctggtcaccaccaacgacggccgcgtgctggcgctcgacgccaaggtc
aacttcgacgacaacgccctgtaccggcacaaggatctcgaggactggcgcgacctgtcc
gaagaagacccggccgagaccgaggccaagaagtacgacctctcgttcatcaagctcgat
ggcaacatcggctgcatggtcaacggcgccggcctggcgatgtcgaccatggacatcatc
aagcactacggcggcgagcccgccaacttcctcgacgtaggcggcggcgccacggccgag
aaggtgaccgcggcgttcaagatcatcaccagtgatccgagcgtgaagagcatcttcatc
aacatcttcggcggcatcatgaagtgcgacaccatcgccaacggcgtggtcaccgcggtc
aaagaagtgggcctcaaggtgccgctggtcgtccggctcgagggcacgaacgtcgacctc
ggcaagaagatcctcgaagagagtggactcaacctggtcgcggcggccgatatggccgac
ggcgccaagaaagctgtggagcacgccaaatga

DBGET integrated database retrieval system