KEGG   Haliangium ochraceum: Hoch_5253Help
Entry
Hoch_5253         CDS       T01103                                 

Definition
CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
hoh  Haliangium ochraceum
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:hoh02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:hoh02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7219788..7220816)
Genome map
AA seq 342 aa AA seqDB search
MSQSRDTIVIGTSSGGVSALRTLLGQLDSALPAAVLIVQHLSPRSPGQLVAVLQRATSMP
VAWVDEPVEIRPGHVYVYVAPPDMHLTIREDRAEVVRGPRENRARPAINPLFRTAAAERG
GRVIAVLLTGLLDDGIAGLESVRRCGGVTVVQDPDDAEFAEMPQRALSAELADHVCCLAG
MGALLRTLVGQPAPASEVPHAITVEARMSGPGRSTPEALTSIGDQVPASCPECGGPLWAV
GAGESSVYRCHTGHALSARALLEMQAEEVERSMWAAVRALTERAAVLERMAGDAEARGHH
RGGDVFRERAREDWAHSEQARQYLLSLRENLPREPEATGTRE
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
ttgagccagagccgcgataccatcgtcattggcacctcgtcgggcggggtgagcgcgctg
cgtacactgctcggccaactcgactccgcgctgccggctgcggtgttgatcgttcagcat
ctgtcgccgcgcagcccgggccagctcgtcgccgtgctccagcgggccacgagcatgccc
gtcgcctgggtcgacgaaccggtcgaaatccggcccggccacgtgtacgtgtacgtggcg
ccgcccgacatgcatctcacgatccgcgaggatcgcgctgaagtggtccgcggaccgcgc
gagaaccgcgcgcgtcccgccatcaatccgctgttccgcaccgcggcggcggagcgcggt
ggtcgggtcatcgcggtgctgctcaccggcctgctcgacgacggcatcgccgggctggag
tcggtgcgccgctgcggcggtgtgaccgtggtgcaagatccggatgacgctgagttcgcc
gagatgccgcagcgggcgctgagcgcggagctcgccgatcacgtctgctgcctggccggg
atgggcgcgctcttgcgcacgctggtcggccagcccgcgcccgcgagcgaggtgccgcac
gccatcaccgtcgaggcgcgcatgagcgggccggggcggagcacgccggaggcgcttacc
agtattggcgatcaggtgcctgcgtcgtgccccgagtgcggagggccgctgtgggcggtg
ggcgcgggtgagagttcggtgtatcgctgccacacgggccacgcgctgtcggcgcgcgcg
ttgctcgagatgcaggccgaagaggtcgagcggtcgatgtgggcggcggtgcgcgccctg
accgaacgcgccgcggttctcgaacgcatggccggcgacgccgaggcccgcggtcaccat
cgcggcggtgacgtatttcgcgagcgggcgcgcgaggactgggcgcactccgagcaggcg
cggcagtatctcttgtcactgcgcgagaacctgccgcgcgagcccgaagcaactgggaca
agagaatga

DBGET integrated database retrieval system