KEGG   Haliangium ochraceum: Hoch_5266Help
Entry
Hoch_5266         CDS       T01103                                 

Definition
pyridoxal phosphate-dependent enzyme, D-cysteine desulfhydrase family (EC:3.5.99.7)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
hoh  Haliangium ochraceum
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:hoh00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Hoch_5266
Enzymes [BR:hoh01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     Hoch_5266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7244371..7245384
Genome map
AA seq 337 aa AA seqDB search
MRSFEYPARRSLARLPTPLEPLPATGAMLGVDLWIKRDDLTGVEMTGNKVRKLEFLLADA
LAKGADTLITCGGEQSNHCRATAFAARQAGMDALLLLRTRDPEQPPPARGNILLDRLVGA
EIQWIDHQTYGNRAQRMAAEAERLRSAGRTPYIIPEGGSNEIGSWGYVAAIEELAEALVA
LPPKPTTIVYACGSGGTGAGLLLGARLFGLDRQGLRLSGVNVCNDRDYFVSAISAICAAF
DERFGVAAGIESGDIDIVDGYVGAGYGQSRPEELAALRELARREGVVLDPVYTGKAFYGM
CQELARDRARFGERVIFLHTGGIFGLLAQAEALAEVL
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgcgttcgttcgaatatcccgcccgccgttcactcgcccgcctgcccacgccgctcgag
ccgctgcccgccacgggcgccatgctgggcgtagatctatggatcaaacgcgacgatctc
accggtgtcgagatgaccggcaacaaggtgcgcaagctggagtttctgctggccgacgcg
ctggccaaaggcgccgacacgctcatcacctgcggcggcgagcagtccaaccactgccgg
gccacggcctttgccgcccggcaggcgggtatggacgcgctgctgctgctgcgcacccgc
gatcccgagcagccgccgcccgcgcgcggcaacatcttgctcgaccgcctggtcggcgcc
gagatccagtggatcgatcaccagacctacggcaatcgggctcagcgtatggccgcggag
gccgagcggctgcgcagcgccggccgcacgccgtacatcatccccgagggcggctcgaac
gagatcggttcgtggggctacgtggccgcgatcgaggaattggccgaggcattggtggcg
ctgccgcccaagcccacgaccatcgtctacgcctgcggctcgggcggcaccggcgccggg
ctgctgctgggcgcgcgtctgttcggactcgatcgccagggcctgcgcctgagcggcgtc
aacgtgtgcaacgatcgcgactacttcgtctccgcgatctcggctatctgtgcggccttt
gacgagcgcttcggcgtcgcggccggcatcgagagcggcgatatcgatatcgtcgacggc
tacgtgggcgccggctatgggcagtctcggcccgaggagctggcggcgctgcgcgagctg
gcgcggcgcgagggcgtggtgctcgacccggtgtacacgggcaaggccttctacggcatg
tgccaggagctggcgcgcgatcgcgcgcgtttcggcgagcgcgtgatcttcctgcacacg
ggcggaatcttcggcctgctggcccaggccgaggcgctcgccgaggtgctctga

DBGET integrated database retrieval system