KEGG   Haliangium ochraceum: Hoch_5271Help
Entry
Hoch_5271         CDS       T01103                                 

Definition
(GenBank) peptidase M20
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
hoh  Haliangium ochraceum
Pathway
hoh00300  Lysine biosynthesis
hoh01100  Metabolic pathways
hoh01120  Microbial metabolism in diverse environments
hoh01230  Biosynthesis of amino acids
Module
hoh_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:hoh00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Hoch_5271
Enzymes [BR:hoh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Hoch_5271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peptidase_M42
Motif
Other DBs
NCBI-ProteinID: ACY17756
UniProt: D0LXK1
Position
complement(7249017..7250123)
Genome map
AA seq 368 aa AA seqDB search
MSASAVPEQALRDTLLALTAIASPIGEEQALCDAVERRLRASLGEAAVTRHEHSLVVHAA
PRPGLPRIGLIGHLDTVRTEHDGPARIDGERLYGAGAADMKSGLAVMIELSERLERASLP
CDLTLVFYEREEGPFEENMLGPLLERFDALRQLDLAICLEPSDNKLQLGCMGSVHATVRF
LGRTSHSARPWQGENAITGAADFLALLRDRAPNDVVLDGHHFREVVSPTMASGGRGRNII
PDSFEINVNYRFAPGRTPEQVVDELRALVRECAGDRAELVPTDLSPAGRPHASHPLVLHL
RDCGVSALETKQAWTDVARFDAAGVPAVNFGPGTQAQAHQRNEYTELPPLYAGYAILERF
LSSVPAPA
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgcgtctgccgtccccgagcaggcgctgcgcgacaccctgctggcgctcacggcc
atcgccagccccatcggcgaggagcaggcgctgtgcgacgcggtcgagcgccggctgcgc
gccagcctgggcgaggccgcggtgacgcgtcatgagcacagcctggtggtgcacgcggcg
ccgcgtcccgggctgccgcgcatcggcctcatcggccacctcgacaccgtgcgcaccgaa
cacgacggacccgcgcgcatcgacggcgagcggctctacggcgccggtgcggccgatatg
aaatccggcctggcggtgatgatcgagctcagcgagcggctcgagcgcgcgtccttgccc
tgcgacctcaccctggtgttctacgagcgcgaggaggggcccttcgaggagaacatgctg
ggcccgctgctcgagcgcttcgacgccctgcgccagctcgacctggccatctgcctcgag
cccagcgacaacaagctgcagctcggctgcatgggctcggtgcacgccaccgtgcgcttt
ctcggacgcacgtcccacagcgcccggccgtggcagggcgagaacgccatcaccggcgcg
gccgacttcctggccctgctgcgcgaccgcgcgcccaacgatgtcgtgctcgacggccac
cacttccgcgaggtggtgtcgccgaccatggccagcggcggccgcggtcgcaacatcatc
cccgacagcttcgagatcaacgtcaactaccgcttcgcccccgggcgcacgcccgagcag
gtggtcgacgagctgcgcgcgctggtgcgcgagtgcgcgggcgatcgcgccgagctcgtg
cccaccgatctcagcccggccgggcgtccgcacgccagccatccgctggtcctgcacctg
cgcgactgcggcgtgagcgcgctcgagaccaagcaggcgtggaccgatgtggcccgcttc
gacgccgccggcgtgccggccgtcaacttcgggcccggcacccaggcccaggcccatcag
cgcaacgaatacaccgagctgccgccgctctacgccggctacgccatcctcgagcgcttc
ctcagcagcgtgccggcgcccgcctga

DBGET integrated database retrieval system