KEGG   Haliangium ochraceum: Hoch_5413Help
Entry
Hoch_5413         CDS       T01103                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
hoh  Haliangium ochraceum
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:hoh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Hoch_5413
   00670 One carbon pool by folate
    Hoch_5413
Enzymes [BR:hoh01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Hoch_5413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7437558..7438166
Genome map
AA seq 202 aa AA seqDB search
MSSPSAPPNDTSSASTPADAEHVFDLVVVADLDGGIARKGEIPWHLSADLRHFQQLTRTT
AEPAQQNAVIMGRKTWESLPAASRPLPSRRNIVLSRDAELTLPPGVVHAAELEAALAATD
LATPPIDRRFIIGGKGVYAEAMQRRGCRHIFYTEIQDRFDCDLFFPAFKDRFKRTDLLAE
GEEKGIGYRIEVWTRTGFPGPV
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgagttctcccagtgctccgcccaacgacacaagctcggcttcgaccccggcggatgcc
gagcacgtcttcgacctggtcgtggtcgccgatctcgacggcggcatcgcccgcaagggc
gagatcccgtggcacctctcggccgacctgcgccacttccagcagctcacccgcaccacg
gccgagccggcgcagcagaacgccgtcatcatgggccgcaagacctgggagagcctgccc
gcggccagccgcccgctgcccagccggcgcaacatcgtgctcagccgcgacgctgagctg
acgctgccgcccggggtcgtgcacgcggccgagctcgaggccgccctggccgccaccgat
ctggcgacgccgcccattgaccggcgcttcatcatcggcggcaaaggcgtctacgccgag
gccatgcagcgacgcggctgccgacatatcttctacaccgagatccaggaccgcttcgac
tgcgacctgttcttccccgcgttcaaagaccgcttcaagcgcaccgacctgctcgcggaa
ggcgaggagaagggcatcggctaccgcatcgaagtgtggacccgcacgggctttcccggc
cccgtctga

DBGET integrated database retrieval system