KEGG   Haliangium ochraceum: Hoch_5539Help
Entry
Hoch_5539         CDS       T01103                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hoh  Haliangium ochraceum
Pathway
hoh00010  Glycolysis / Gluconeogenesis
hoh00620  Pyruvate metabolism
hoh00640  Propanoate metabolism
hoh00680  Methane metabolism
hoh01100  Metabolic pathways
hoh01110  Biosynthesis of secondary metabolites
hoh01120  Microbial metabolism in diverse environments
hoh01130  Biosynthesis of antibiotics
hoh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hoh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hoch_5539
   00620 Pyruvate metabolism
    Hoch_5539
   00640 Propanoate metabolism
    Hoch_5539
  Energy metabolism
   00680 Methane metabolism
    Hoch_5539
Enzymes [BR:hoh01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Hoch_5539
Lipid biosynthesis proteins [BR:hoh01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Hoch_5539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACY18022
UniProt: D0LZP3
Position
complement(7598681..7600630)
Genome map
AA seq 649 aa AA seqDB search
MSEIESVLHEDRRFTPPEHFADKARVKSMQEYEALYERAKEDPAAFWGEVAKELHWFEPW
SEVLSWNLPDAKWFVGATTNLSYNCLDRHLGTGRRNKAALIWEGEPGEQRILTYHQLHRE
VCKLANLLEGMGVGAGDRVAIYMPMIPESAIAMLACARIGATHSVIFGGFSAEALAERVS
DAGARTIITADGGWRRGKVIPLKANVDKACERCEVERVLVVRRCGNQVAWQDGRDHWWHE
RMAEASATHEAAPLDAEHPLFLLYTSGTTGKPKGILHTTGGYMVHTYFTARMVFDLREDD
TFWCSADVGWVTGHSYLVYGPLANGSTCVMYEGAPNYPEPDRFWDIIERYGVTIFYTAPT
AIRAFERWGDEWPQRHDLSSLRLLGTAGEPINPKAWIWYHTVIGGERCPIVDTWWQTETG
GMMISPLPGATPTKPGSATRPLPGIMADVVRRDGTRCEDNEGGLLVVRQPWPGMLRTIYG
DHERFTETYFGQVDGVYYAGDGARRDEDGYIWVMGRMDDVINVSGHRLSTMEVEAALDSH
DKIAEAAVVGRPDELSGQAIVAFVTPMAGAEPGEALSDELRQHVAEQIGALARPAQIRFA
DSLPKTRSGKIMRRLLRDIAAGAAAQGDTSTLEDSSVLDKLAAERGYEE
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagatcgagtccgttcttcacgaggatcgccgcttcacgccgcccgagcacttc
gccgacaaggctcgggtcaagagcatgcaggagtacgaggcgctctacgagcgggcgaag
gaggacccggcggcgttctggggcgaggttgccaaagagctgcactggttcgaaccctgg
tccgaggtgctgtcgtggaatctgcccgacgccaagtggttcgtcggcgccacaaccaat
ctctcgtacaactgtctggaccgacatttaggcaccggccgccgcaacaaggcggcgctg
atctgggagggcgagcccggcgaacagcgcatcctcacgtatcaccagctccaccgcgag
gtgtgcaagctggccaatctgctcgagggcatgggcgtgggcgcgggcgaccgcgtggcc
atctatatgcccatgattcccgagtcggccatcgcgatgctggcgtgcgcacgcatcggc
gccacgcactcggtgatctttggcggcttctcggccgaggctctggccgagcgcgtgagc
gatgccggcgctcgcaccatcatcacggccgatggcggctggcgacgcggcaaggtgatt
ccgctcaaggccaatgtggacaaagcctgcgagcgctgcgaggtcgagcgcgtgctggtg
gtgcgccgctgcggcaaccaggtggcctggcaagacggccgcgatcactggtggcacgag
cgcatggccgaggcttcggccacgcacgaggccgcgccgctcgacgccgaacacccgctg
tttctgctctacaccagcggcaccacgggcaagcccaagggcatcctgcacaccacgggc
ggctacatggtgcacacttacttcaccgcgcgcatggtcttcgatctgcgcgaggacgac
accttctggtgctcggccgatgtcggctgggttaccggacactcgtacttggtctacggt
ccgctggccaacggctccacctgcgtgatgtacgagggtgcgcccaactatcccgagccc
gaccgcttctgggacatcatcgagcgctacggcgtcaccatcttttacaccgcgcccacg
gcgatccgcgcgttcgagcgctggggagacgagtggccccagcgccacgatctctcgagt
ctgcggctgctcggcacggccggcgagccgatcaatcccaaggcgtggatctggtaccac
acggtcatcggcggcgagcgctgtccgatcgtcgacacctggtggcagaccgagaccggc
ggcatgatgatctcgccgctgcccggggccacgccgaccaagccgggctcggccacgcgt
ccgctgcccggtatcatggccgatgtggtcaggcgcgacggcacgcgctgcgaggataac
gagggcggtttgctggttgtccgccagccctggcccggcatgctgcgcacgatctacggc
gaccatgagcgtttcaccgagacttatttcggacaggtcgacggcgtctactacgccggc
gatggcgcccgccgcgatgaggacggctatatctgggtgatgggacgcatggacgacgtc
atcaatgtctcgggtcaccggctgagcacgatggaggtcgaggcggcgctggattcgcac
gacaagatcgccgaggcggccgtggtcggccgtcccgacgagctgagcggccaggccatc
gtggcctttgtgacgccgatggcgggcgcggagccgggcgaggcgctgagcgacgagctg
cgccagcacgtggccgagcagatcggcgcgctggcgcgaccggcccagatccgcttcgcc
gattcgctgcccaagacgcgctcgggcaagatcatgcgccggctgctgcgcgatatcgcc
gcgggggctgcggctcagggcgacacgagcacgctcgaagactcctcggtgctcgacaag
ctggcggcggagcgcgggtatgaggaatag

DBGET integrated database retrieval system