KEGG   Haliangium ochraceum: Hoch_5748Help
Entry
Hoch_5748         CDS       T01103                                 

Definition
RecD/TraA family helicase (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
hoh  Haliangium ochraceum
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:hoh03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7881249..7883555
Genome map
AA seq 768 aa AA seqDB search
MAGSPGNGPRTERHRQRRTPVADDPAQTGSVVEGTLTRIVYENADTHWTVARVRVGDDEA
GTTRDPAARAEGEITVVGSMVGVAPGTPLRLRGTWEQHNSYGRQFRVHSYQARMPETIAG
LERYLGSGEFRGIGPELAKRIVEHFGLEALSVIEKAPKRLQEVDGIGAARAEKIAEAWTA
QRDVHDVMVFLRGYGVTASQAARIHKRYGNRAEAIVRENPYRLALDIWGIGFKTADSIAQ
NLGMARDAPERLEAGLIHVLGKLAEDGHVHVPEPNLLDTAAGILEVDAMLLPEALDRLET
SQLVVCEALGDRGTCVSLTFLWQHESDAAARYAALVETPMRPRKLDLDQALAAFEAEAEL
ALTAEQRRAALAAVMDKSVVLTGGPGVGKTTIVRAIVFLFERLGRSVTLAAPTGRAAKRL
AESTARDAATIHRLLEFQPAGGGFFRSADNPLDSDVVIIDETSMVDIALLAALLDAMPAS
AQLVLVGDIDQLPSVGPGAVLADLIASRAATVVRLTEIFRQARESRIVMAAHEINSGMVP
QLAPPQGTSAHRSDFYFISREQPVRARETIVDLVAERIPEAFGFDPLADIQVLCPVHRGE
LGTIALNRALQERLTPAVDEQHQVTRGERSYRVGDKVMQLENDYDRGVFNGDIGVIFEIA
GERKKVLVDYMDGRVVGYEARDLDQLTHAYAISVHKSQGSEYPVVVLPLATQHYIMLQRN
LLYTAVTRGKSLVVIVGSAKAVRRAVENQTNTARWTWLAERIREQLGE
NT seq 2307 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcagccccggcaacggcccgcggacagagcgccacaggcagcgacgcacacct
gtggccgatgatcccgcccagacaggttcagtcgtcgagggcaccctgacgcgtatcgtc
tacgagaacgcggacacccactggaccgtggcgcgggtgcgggtcggcgacgacgaggcc
ggcacgacgcgcgatccggccgcgcgcgccgagggcgagatcaccgtggtgggctcgatg
gtcggcgtggccccgggcacgccgctgcgcctgcgcggcacctgggagcagcacaacagc
tacggccggcagtttcgcgtgcacagctaccaggcgcgcatgcccgagaccatcgccggg
ctcgagcgctacctcggctccggcgagtttcgcggcatcggccccgagctggccaagcgc
atcgtcgagcacttcggcctggaggcgctgagcgtcatcgagaaggcgcccaagcggctg
caggaagtcgacggcatcggcgccgcgcgggccgagaagatcgccgaggcgtggaccgcg
cagcgcgacgtccacgacgtcatggtgttcttgcgcggctacggcgtcaccgcgtcgcag
gccgcgcgcatccacaagcgctacggcaatcgcgccgaagccatcgtgcgcgagaacccc
tatcgcctcgcgctcgacatctggggcatcggcttcaagaccgccgacagcatcgcccag
aacctgggcatggcgcgcgacgcgcccgagcggctcgaggccggcctgattcacgttctc
ggcaagctggccgaagacggccacgtgcacgtgcccgagcccaacctgctcgacaccgcg
gccggaatcctcgaggtcgacgccatgctcttgcccgaggcgctcgaccggctcgagacc
tcgcagctcgtggtctgcgaggccctgggcgaccgcggcacctgcgtctcgctcaccttc
ctgtggcagcacgagagcgacgccgccgcgcgctacgccgccctggtcgagaccccgatg
cggccgcgcaagctcgatctcgaccaagccctggccgcgttcgaggccgaggccgagctc
gcgctcacggccgagcagcggcgcgccgccctggccgcggtgatggacaagagcgtggtg
ctcaccggcggccccggcgtcggcaagaccaccatcgtgcgcgcgatcgtgttcctgttc
gagcgcttggggcgcagcgtgaccctggccgcgccgaccgggcgcgcggccaagcgcctg
gccgagagcaccgcgcgcgacgccgccaccattcatcgcttgctcgagtttcagcccgcg
ggcggcggcttctttcgcagcgcggacaatcccctcgacagcgatgtggtcattatcgat
gagacctcgatggtcgatatcgccctgctcgccgccctgctcgacgccatgcccgcgagc
gcacagctcgtgctggtcggcgatatcgaccagctcccgtccgtgggcccgggcgccgta
ctcgccgacctcatcgcctcgcgcgcggccaccgtcgtgcgcctcaccgagatctttcgg
caggcgcgcgagagccgcatcgtcatggccgcgcacgagatcaacagcggcatggtgccg
cagctcgcgccgccgcagggcaccagcgcgcatcgctcggatttctacttcatctcgcgc
gagcagcccgtgcgcgcgcgcgagaccatcgtcgatctggtcgccgagcgcatccccgag
gcctttggattcgacccgctggccgatatccaggtgctgtgtccggtgcatcgcggcgag
ctgggtacgatcgcgctcaaccgcgccttgcaggagcggctcacgcccgcggtcgatgag
caacatcaggtgacgcggggcgagcgcagctatcgcgtgggcgataaagtcatgcagctc
gagaatgactacgaccgcggcgtgttcaacggcgatatcggcgtgatcttcgagatcgcg
ggtgagcgcaagaaagtcctcgtcgattacatggacggacgcgtggtcggatacgaggcc
cgcgacctcgaccagctcactcacgcgtacgcgatcagcgtgcacaagagccagggctcg
gagtatccggtcgtggtgctgccgctggccacgcagcactacatcatgttgcagcgcaat
ctgctgtacactgccgtaacccgcggcaaatcgctggtcgttatcgtcggctcggcgaaa
gccgtgcgccgggcggtcgagaatcagaccaataccgcgcgctggacctggctcgccgaa
cgcatccgcgaacagctcggcgaatga

DBGET integrated database retrieval system