KEGG   Haliangium ochraceum: Hoch_6139Help
Entry
Hoch_6139         CDS       T01103                                 

Definition
acetate/CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hoh  Haliangium ochraceum
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hoh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hoch_6139
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hoch_6139
   00620 Pyruvate metabolism
    Hoch_6139
   00640 Propanoate metabolism
    Hoch_6139
  Energy metabolism
   00680 Methane metabolism
    Hoch_6139
Enzymes [BR:hoh01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Hoch_6139
Lipid biosynthesis proteins [BR:hoh01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Hoch_6139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8406757..8408739)
Genome map
AA seq 660 aa AA seqDB search
MAEQSDDLYPVPERVSAGSPSTIKDMNSYRDVVSRAATDPDGFWLGVTRERIAWASEPTL
GLEGSYHEVADGPFSWFSDGTLNVTESCLDRHAREQPDKVAILWEGDEPDERRELTYRQL
LDEVCRTANALRRLGLQKGERAIIYMGMVPEAAIAMLACARLGAVHSVVFGGFSAEALRD
RVRDSQAEIVITQDEGRRGGRSIPLKAVCDQALVGESSVRHVLCYQRTGVEVGWEEGRDH
WWHEEVAKESSECAPEIVEAEHPLFILYTSGSTGKPKGLVHTSGGYLTYVSYTHQVVFDL
REDDVYACVADIGWITGHSYIVYGPLANGATTMMFESTPLYPDAGRYWDMIERYGITIFY
TAPTALRTLAAADASLITRRDRSSLRVLGTVGEPIDAETWKWYRTVVGEERCTIVDTWWQ
TETGGMCLSPIAPATPTRPGSATLPLPGIFPLLMDEQGHRMRGPGAGRLCLEQPWPGQAR
TVWGDHERYVATYFSMFPGLYFTGDGCRRNGDGYHWITGRVDDVLNISGHRVGTAEIEAA
LVALDAVAEAAVVGYPHPIKGQGVYAWVVLQPGVEIGDELHKSLGQTCRHHIGAHARLDE
VRFTPALPKTRSGKVMRRILRKLAEGALKDAPAGDRSVLGDLSTLADPGLVDTLVELSEK
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atggctgaacagagcgacgacttgtaccctgtgcccgagcgcgtgagcgccgggtccccg
tctacgatcaaagacatgaactcctaccgcgacgtggtgtcgcgcgcggccaccgaccca
gacgggttctggctcggtgtcacccgcgagcgcatcgcgtgggcgagtgaaccgacgctc
ggtctcgagggctcgtaccacgaggtcgcagacgggcccttctcctggttctccgacggc
acgctcaacgtcaccgagtcctgtctcgaccgccacgcccgcgagcagcccgacaaggtc
gcgatcctctgggaaggcgacgagcccgacgagcgccgtgagctcacctatcgccagctc
ctcgacgaggtctgtcgcacggctaacgcgctgcgtcgcctgggcctgcaaaagggcgag
cgcgcgatcatctacatgggcatggtgcccgaggccgcgatcgcgatgctggcgtgcgcg
cgtctgggcgcggtgcactcggtggtgttcggcggcttctcggccgaggcgctgcgcgac
cgcgtgcgcgactcgcaggccgagatcgtcatcacccaggacgagggacgccgcggcggc
cgctcgatcccgctcaaggcggtgtgcgaccaggcgctggtcggcgagagcagcgtgcgc
cacgtgctgtgctatcagcgcacgggcgtcgaggtcggctgggaggagggccgcgaccac
tggtggcacgaggaggtcgccaaggagtcgagcgagtgcgcgcccgagatcgtcgaggcc
gagcatccgctgttcatcctctacacctcgggttcgaccggaaagcccaagggcctggtg
cacacctcgggcggctacctcacctacgtgagctacacgcatcaggtcgtgttcgatctg
cgcgaggacgatgtctacgcctgcgtggccgacatcggctggattaccggacactcgtac
attgtctacggtccgctggccaacggcgcgaccacgatgatgttcgagtccacgccgctg
tatcccgacgccgggcgctactgggacatgatcgagcgctacggcatcaccatcttctac
accgcgccgaccgcgctgcgcacgctggccgcggccgatgcgtcgctgatcacgcggcgc
gaccgctcgagtctgcgcgtgctcggcacggtgggcgagcccatcgatgccgagacctgg
aagtggtaccgcacggtggtcggcgaggagcgctgcacgatcgtcgatacctggtggcag
accgagaccggcggcatgtgtctgtcgccgatcgcgccggccacgccgacgcggccgggc
tcggcgacgctgccgctgccgggtatcttcccgctgctgatggacgagcagggccaccgc
atgcgcgggccgggcgccgggcggctgtgtctggagcagccctggccggggcaggcgcgc
acggtgtggggcgaccacgagcgctacgtggcgacctacttctcgatgttcccggggctg
tacttcaccggcgatggctgccgccgcaacggcgacggctaccactggatcacgggccgc
gtcgacgatgtgctcaacatcagcggtcaccgggtgggtacggccgagatcgaggccgcg
ctggtggcgctcgacgctgtcgccgaggccgccgtggtcggctatccgcacccgatcaag
ggtcagggcgtgtacgcctgggtggtgctgcagccgggcgtcgagatcggcgacgagctg
cacaagagcctgggccagacctgccgccatcacatcggcgcgcacgcgcggctcgatgag
gtgcgcttcacgcccgcgctgccgaagacgcgctcgggcaaggtcatgcgccgcatcctg
cgcaagctcgccgaaggggcgctgaaggacgcgcccgcgggcgaccgcagcgtgctcggc
gatctgtcgaccctggccgatccgggcctggtcgacaccctggtcgagctgtccgagaag
tag

DBGET integrated database retrieval system