KEGG   Haliangium ochraceum: Hoch_6429Help
Entry
Hoch_6429         CDS       T01103                                 

Definition
stearoyl-CoA 9-desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
hoh  Haliangium ochraceum
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:hoh00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Hoch_6429
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Hoch_6429
Enzymes [BR:hoh01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Hoch_6429
Lipid biosynthesis proteins [BR:hoh01004]
 Desaturase
  First
   Hoch_6429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8819027..8820004
Genome map
AA seq 325 aa AA seqDB search
MATAPPTIPVSTPNSGDYSVRWLQSIPFWAVHVAAVVGVIWLGWSWSGLALALGLYFVRM
FGITGGYHRYFSHRSYKTGRVMQFLLALLGGLSTQKGVLWWAAHHRNHHKYSDQPEDVHS
PRQRGFYWSHMGWILVKKHEVIHWDRIPDLAKYPELRFLTRYDQYIAVAFAVLLFALGGA
WALVWGYFVSTVLLWHGTFTINSFSHIFGRRRYDTDDDSRNNWLLAIITLGEGWHNNHHY
YQRSVRQGFYWWEIDITYYVLVALSWLGLVSDLQGVPEHVRDPEAARERLARKAARAAEA
KSAGDLDDGDLPPTGDDPASEHLPA
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccgcccctcccaccatccctgtctcaacgccgaacagtggcgactacagcgtt
cgctggctgcagagcattccgttctgggccgttcacgtggccgccgtcgtcggcgtcatc
tggctcggctggtcctggtccggcctggccctggccctgggcctgtacttcgtgcgcatg
ttcggcatcaccggcggctaccaccgctacttctcccaccgctcgtacaagaccggtcgc
gtgatgcagttcctgctcgcgctgctcggcggtctcagcacccagaaaggcgtgctgtgg
tgggccgctcatcaccgcaaccaccacaagtactcggaccagcccgaggacgtgcactcg
ccccggcagcgcggcttctactggtcgcacatgggctggatcctggtaaagaagcacgag
gtcatccactgggaccgcatccccgatctcgccaagtaccccgagctgcgcttcctcacc
cgctacgaccagtacatcgcggtcgcgttcgcggtgctgctgttcgcgctgggcggcgcc
tgggccctggtctggggctacttcgtgtccaccgtgctgctgtggcacggcaccttcacg
atcaactcgttctcgcacatcttcggtcgccgccgttacgacaccgacgatgacagccgc
aacaactggctcctcgcgatcatcaccctgggcgagggctggcacaacaaccatcactac
taccagcgctcggtgcgccagggcttctactggtgggagatcgacatcacctactacgtg
ctcgtggcgctgtcgtggctgggcctggtgagcgacctgcaaggcgtgcccgagcatgtc
cgcgaccccgaggcggcgcgcgagcgtctggctcgcaaggccgcgcgcgcggccgaagcc
aagtccgccggggacctcgacgacggcgacctgccgccgacgggcgacgatcccgcgagc
gagcacctgcccgcctga

DBGET integrated database retrieval system