KEGG   Haliangium ochraceum: Hoch_6562Help
Entry
Hoch_6562         CDS       T01103                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
hoh  Haliangium ochraceum
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:hoh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Hoch_6562
Enzymes [BR:hoh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Hoch_6562
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9007257..9007862
Genome map
AA seq 201 aa AA seqDB search
MEKNQRALDLFTKGFESILEGIGELGYDITDANFADTAPRAAKGLHELIHDQAKAQDEVK
KLLSKTFPARYTEMVISKHNVAFGVCPHHILPVIYRISLAYIPVKKVLGLSKLSRLARLY
ARSPMLQEDLTHELCRTLHEDLESEGAAVYIEGLHMCMAARGIGAHEARLVTSAVRGVFL
NEPATRNEFIKLVTTAHPPLV
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaaaccaacgcgcgctcgacctcttcacgaaaggcttcgagtcgatcctcgaa
ggcatcggcgagctcggctacgacatcaccgacgccaacttcgccgacaccgcgccgcgc
gcggccaaaggcctccacgagctcatccacgaccaggcgaaagcccaggacgaagtaaag
aagctgctcagcaagaccttcccggcccgctacaccgagatggtcatctccaagcacaac
gtcgccttcggcgtgtgcccgcaccacattctgcccgtgatctatcggatctcgctggcc
tacatcccggtgaagaaggtgctcgggctgtccaaactcagccgcctggcgcgcctgtac
gcgcgctcgcccatgctgcaggaagacctcacccacgagctgtgccgcacgctgcacgag
gacctcgagagcgagggcgccgccgtgtacatcgagggtctgcacatgtgtatggccgcg
cgtggcatcggcgcccacgaggcccggctggtgaccagcgcggtgcgcggcgtgttcctc
aacgaaccggccacgcgcaacgagttcatcaagctggtcacgaccgcgcacccgcccctg
gtctga

DBGET integrated database retrieval system