KEGG   Haliangium ochraceum: Hoch_6744Help
Entry
Hoch_6744         CDS       T01103                                 

Definition
uracil-DNA glycosylase superfamily
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
hoh  Haliangium ochraceum
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:hoh00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Hoch_6744
Enzymes [BR:hoh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     Hoch_6744
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9258081..9258806
Genome map
AA seq 241 aa AA seqDB search
MKLASISRRLAKSVDALSFAAPVTHVYDPLVYARKPHEAYLSRYGQGPREIVLVGMNPGP
FGMAQTGVPFGEIAAVRDWMGIEEPVAKPPNEHPKRPILGFACTRSEVSGARLWGWAQER
FGTAEDFFARFFITNYCPLVFMEESGRNFIPEKLPKDEREPLFEACDDALRRTVSELAPR
YVIGVGAFATRRIEHALSDKTLAKLTVGTVLHPSPASPLANRGWAERAEADLRGLGVALP
D
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcgcaagcatcagccgccggctggccaagagcgtggacgcgctgtccttcgcg
gccccggtgacccacgtctacgatcccctggtctacgcgcgcaagccgcacgaggcctac
ctcagccgctacggccagggcccgcgcgagatcgttctggtgggcatgaacccggggccc
ttcggcatggcccagaccggtgtgcccttcggcgagatcgcggcggtgcgcgactggatg
ggtatcgaggagccggtggccaaaccaccgaacgagcatcccaaacggcccatcctcggc
ttcgcgtgcacgcgctcggaggtgagcggcgcgcgcctgtggggctgggcccaggagcgc
ttcggcacggccgaggacttcttcgcgcgcttcttcatcaccaactactgcccgctggtg
ttcatggaggagagcgggcgcaacttcatccccgagaagctgcccaaggacgagcgcgag
ccgctcttcgaagcctgcgacgacgcgttgcggcgcaccgtgagcgagctcgcgccgcgc
tatgtcatcggcgtcggcgccttcgccacgcgccgcatcgaacacgcactgagcgacaag
accctggccaaactcaccgtcggcaccgtgctccatcccagcccggccagccctctggcc
aaccgcggttgggccgaacgcgccgaagccgacctgcgcggcctgggcgtcgcgctgcca
gattga

DBGET integrated database retrieval system