KEGG   Haliangium ochraceum: Hoch_6788Help
Entry
Hoch_6788         CDS       T01103                                 

Definition
response regulator receiver modulated CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
hoh  Haliangium ochraceum
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:hoh00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Hoch_6788
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Hoch_6788
Enzymes [BR:hoh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Hoch_6788
Two-component system [BR:hoh02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Hoch_6788
Bacterial motility proteins [BR:hoh02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Hoch_6788
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9310215..9311246
Genome map
AA seq 343 aa AA seqDB search
MSVRVLIVDDSSFVREVLREVLTQQPDIEVVGEASDGKRAESLVQELRPDVVTMDVVMPM
LSGLDAIRRIMSRCPTPIIVVSDADSATRELAMQALAAGAIDTFAKPRTGFDQRSAEQLI
ALVRSAANARGKVARSAARMPPPSLRAAQQRVAKAGCIGIVASTGGPQTLQRVLAKLPPK
PSVPIAIVQHTSVGFTRALASWLTAALPVPVTLARDRQRVAPGQILLAPDDTHLEIEAGG
TTRLHHGARLGNHRPSGTLLLKSLARAYRASAVGIVLTGMGDDGADGAQTLEIAGGLVLV
EEPRTAILEGMPRAAVQHTQRSLVASADRLGELLGAALGSRDA
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtccgcgtcctgatcgtcgatgattcctcgttcgtgcgcgaggtgctgcgcgag
gtgctcacccagcagcccgatatcgaggtcgtcggcgaggcctcggacggcaagcgcgcc
gagagcctggtgcaggagctgcgccccgacgtggtcaccatggacgtggtcatgcccatg
ctcagcggcctcgacgccatccggcggattatgtcccgctgtccgacgcccatcatcgtg
gtctcggacgccgacagcgccactcgcgagctcgccatgcaggccctggccgccggtgcc
atcgacaccttcgccaaaccgcgcaccggcttcgaccagcgctcggccgagcaactcatc
gcgctggtgcgctcggccgccaacgcgcgcggcaaggtagcgcgctcggcggcccggatg
ccgccaccgagtctgcgcgcggcccagcagcgagtggccaaggccggctgcatcggcatc
gtggcctcgaccggcggtccgcaaaccctgcagcgcgtgctcgccaagctgccgccgaag
ccgagcgtgcccatcgccatcgtccagcacacctcggtcggcttcacccgcgcgctggcc
tcgtggctcacggcggcgctgccggtgcccgtgacgctcgcgcgcgatcgccagcgcgtc
gcgcccggccagatcctgctggcgcccgacgacacccacctggagatcgaagccggcggc
accacgcgcctgcaccacggcgcgcgcctgggcaatcaccggccctcgggcacgctgctg
ctcaaatcgctggcgcgcgcgtatcgcgccagcgcggtcgggatcgtgctcaccggcatg
ggcgacgatggcgccgatggcgcgcagacgctcgagatcgcgggcggcctggtcctggtc
gaggagccgcgcacggcgattctcgagggcatgccgcgggccgccgtgcagcacacgcag
cgctcgctcgtggcctcggccgatcgcctcggcgagctgctcggcgcggccctcggcagt
cgggacgcgtga

DBGET integrated database retrieval system