KEGG   Halothermothrix orenii: Hore_00700Help
Entry
Hore_00700        CDS       T00838                                 

Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--lysine ligase (EC:6.3.2.7)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
hor  Halothermothrix orenii
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:hor00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Hore_00700
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Hore_00700
Enzymes [BR:hor01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Hore_00700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(81799..83241)
Genome map
AA seq 480 aa AA seqDB search
MVMERKEDLPAFTDITCDSREVKPGYAFVAITGFKNDGHNFIEEAINKGASVIFTEKEIK
SRSGIPIVRVKDSRSILGKLAAEFYNYPSRKLKLIGVTGTNGKTTTTHLIYHLLNYKGKN
SGLIGTVKVDTGKRTIPGNLTTPEPVTLQKYLDEMVKHNLNYACMEVSSHGIKLKRITGS
QFAIKVGTNITVDHFDLHSDFSDYVQVKKSFLEDKNPHTLVLLNNDDHYLSSFGNIAKNQ
IGYGITTNTDITAENINYSGITTDFVYSLNKSIKTSQGNKIGPMKVPINLKIPGEHNIYN
ALVAITIGLYYGLTPEKIQDFFGQFRGIWRRFQVIYNKDFAIIDDCAHNPGSYGAVFKTV
SQLKYKNLLIVNAIRGNRGAQINKGNAETIGKWLKKFHNYYLLTTNCNDVVKPIDKVSPE
EEKVFLQALDKNNIKYSHLDQLKPALKNVLDKVTPDDIILLLGAHAMDEAGDMILEMIKE
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggtaatggaaagaaaggaagacctccctgcctttacagatataacctgtgattcaaga
gaagtaaaaccgggatatgcttttgtagccataacggggttcaaaaatgatggacataat
tttattgaagaagctattaataaaggggccagtgtcatattcacggaaaaggaaataaaa
tcccggagtggtattcccatcgtccgggttaaagatagtcgctctatactgggaaagctg
gcagctgaattttataattacccatcccgcaaattaaaactgataggtgttaccggaaca
aacgggaaaacaacaaccacccacctgatttatcatttacttaactataaaggtaaaaat
tcagggctaataggtacagtaaaagtcgataccggtaagagaacaatacccggaaactta
acaacacctgaaccggttaccctacaaaaatatcttgatgaaatggtaaaacacaatctt
aattatgcctgtatggaagtctcctcccatggtatcaaattaaagaggattaccggtagt
caatttgcaataaaagttggtactaacattacagtcgaccattttgaccttcattcagac
ttctctgattatgtccaggtaaaaaaatcctttctggaagataaaaacccccataccctt
gttttattaaataatgatgaccattatttaagttcttttggtaatatcgctaaaaatcaa
attgggtatgggattaccacaaatacagatattacagcagaaaatattaattacagcgga
attactactgactttgtttactcactaaataaatcaataaaaaccagccagggtaataaa
ataggaccgatgaaggtccctattaatcttaaaatacctggagaacataacatttataat
gccctggtagctataacaattggcctctattatggtttaacacctgaaaaaatccaggac
ttttttggccagttcaggggaatctggcggagattccaggtgatttacaacaaagatttt
gcaattatagatgactgtgcccataatcccggtagctatggagcagtttttaaaacagta
agccagctcaaatataaaaatctattaattgttaatgctatcagaggaaacagaggagcc
cagatcaataaaggaaatgcagaaacaataggaaagtggcttaaaaaatttcacaattac
tatttgttaaccacaaactgtaatgatgttgttaaaccaattgataaggttagccctgag
gaagaaaaagttttcctgcaggccctggacaaaaacaatattaaatatagccatctcgat
caattaaaacctgccttaaaaaatgttctggataaggttacacccgatgatataattctc
ctactgggggcccatgctatggatgaagccggtgacatgattctagagatgatcaaggaa
taa

DBGET integrated database retrieval system