KEGG   Halothermothrix orenii: Hore_01920Help
Entry
Hore_01920        CDS       T00838                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
hor  Halothermothrix orenii
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:hor00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Hore_01920
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Hore_01920
Enzymes [BR:hor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Hore_01920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
198239..199402
Genome map
AA seq 387 aa AA seqDB search
MGRGRKKKYNRVVVKVGSSTLTHPGGKLNITRIDHLVRQLVDLKNQGREVLLVTSGAIAA
GMGDMNLDVRPGSIPEQQALAALGQGVLIGLYNKFFREYGEKGAQILLTASDLEDRGRYL
NAFNTLLTLLKHGVIPVINENDTVATQEIKFGDNDTLSARVAGLVEADLLIVLSDVEGLY
NGVPGEGSDLEVIRVVEDITPDVEGLAGGRGSSVGTGGMITKIKAARIAVNSGVTMVIGP
GYEKNVLLSLVDMLEKGNNYNKGTTFLPKQDYLTKRKQWLRFNLPVSGSIKVDKGAETAL
VYRGKSLLPGGITGVEGDFSEGEPVRVINHSGKEIGRGLVNYSSEEIRVIQGHHTTDISS
LLGYMKQEEVIHRDNLVIERGKIDNGD
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgggcaggggacgaaagaagaaatataaccgggtggttgttaaggttggtagcagtact
ttaacccacccgggtggaaaattaaatattaccaggatcgaccatcttgtcaggcagctg
gtagatttgaagaaccaggggcgggaagtcctgcttgtgacttcaggtgctattgctgct
ggaatgggagatatgaaccttgatgtcaggcccggttctattcccgaacagcaggccctg
gctgccctcggtcagggagtattaatcggattatataataagtttttcagggaatatgga
gaaaaaggggcccagatattattaactgccagtgacctggaagacagggggcggtattta
aatgcctttaataccctgttaactttattaaaacacggggttatccccgtaataaatgag
aatgatactgttgctacccaggaaattaaatttggcgataatgacaccctgtcggcccgg
gtagccggactcgttgaggctgatcttttgatcgttctgtcagatgttgaaggcctgtat
aacggggttcctggagagggatcagaccttgaagttattagagtagtagaggacattact
cctgacgttgaagggctggccggtgggcggggtagctctgtcgggaccgggggtatgatt
accaagataaaagctgccaggattgccgttaattccggggttactatggttatcggaccc
ggttatgagaagaacgttttattatcactggtagatatgctggaaaagggaaataattat
aataaagggacaacttttcttccaaaacaggattacctgactaaacgaaaacagtggttg
cgctttaacctgccggtcagtggttctataaaagttgataaaggtgctgaaactgccctg
gtataccggggtaaaagtcttttacccggtggtataaccggggttgagggagatttttca
gaaggtgaaccggttagggtaatcaaccacagtggtaaagagatagggagagggttggtt
aattattcatctgaagaaattagagttattcagggacaccacaccacagatattagttct
ttactcggttatatgaaacaggaagaagtaatacaccgggataacctggtaatagaaagg
ggtaagattgataatggagattaa

DBGET integrated database retrieval system