KEGG   Halothermothrix orenii: Hore_02110Help
Entry
Hore_02110        CDS       T00838                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase (EC:1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
hor  Halothermothrix orenii
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:hor00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Hore_02110
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hore_02110
   00620 Pyruvate metabolism
    Hore_02110
   00650 Butanoate metabolism
    Hore_02110
  Lipid metabolism
   00071 Fatty acid degradation
    Hore_02110
  Amino acid metabolism
   00350 Tyrosine metabolism
    Hore_02110
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Hore_02110
   00626 Naphthalene degradation
    Hore_02110
Enzymes [BR:hor01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Hore_02110
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Hore_02110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
216770..219433
Genome map
AA seq 887 aa AA seqDB search
MAKAVLEKSVDKATKEKKEIRKGLKIEDSINKLVERANEAARKFKDYDQEQVDRIVKKMA
LAANDKHIELAKMAHRETGMGVYEDKITKNLFASEYVYNYLRDKKTAGILNKNIEENYIE
VAEPIGVVAALTPVTNPTSTTIFKALICMKTRNPVIFSFHPRAMKCSIEAARILKEAAIK
AGAPENCISWIEEPSIEATNYLMKHPEVDLILATGGSGMVKAAYSSGKPALGVGPGNVPC
YIEKTANIKQAVSDLILSKTFDNGMICASEQAVVVDKEIAAEVKKFMQENGCYFVSKKES
EKLARVAVDQERGAMNPAVVGQPARKIAKMAGIKVPDDTKILVAELKGVGENYPLSREKL
SPILGWYVVKDYREGIKRCEEITEFGGLGHSSVLHSNDEKVIDEFSRRLRTGRLIINSPS
SQGAIGDMYNFNVPSLTLGCGSMGKNSTTDNVNVDNLINKKRVAMRKERMKWVKVPPRIY
FEYGSLRYLSGVRGERAFIITDKTMSQLGFIDKVEEHLSVAGVQTRVFDSVEPDPSVETV
LNGCQEMNEFKPDIIIALGGGSPMDAAKGMWLFYEHPETRFEDLKMKFNDIRKRVYKFPR
LGKKATFIAVPTTSGTGSEVTAFSVITDKKRNIKYPLADYELTPDIAIIDPELVLTVPQS
VTADTGLDVLTHAIEAYVSVMASDYTDALAEKAIKLVFEYLPRAYKNGNDREARKKMHNA
SCIAGMAFTNAFLGLNHSMAHILGGKFHIPHGRANAILLPHVIRYNAGKPSKLASFPQYD
YPRAGERYAEIARILGLPASTTEEGVESLVKAITDLMRELNIPLSLEEAGVNHNKFEKEL
EDMADIAHNDQCTGTNPRMPLVNEIKEIYRQAYKGVSIKDKKKVRNA
NT seq 2664 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagcggtattagaaaaaagtgttgataaggctacaaaggaaaagaaagagatt
agaaaaggtttaaagattgaagatagtatcaacaaactggtagaaagggcaaatgaagct
gccaggaagtttaaagattatgaccaggaacaggttgacaggattgtaaaaaagatggct
ctggccgccaatgataaacatattgaacttgctaaaatggcccatcgggaaacaggaatg
ggggtctatgaagataaaataactaaaaatctttttgcttctgagtatgtttataactat
ctcagggataagaaaacagctggaattttaaataaaaacattgaagaaaattatattgag
gttgcagaaccaatcggggttgtagctgctttaactcctgttaccaatcctacttctact
actatttttaaggctttaatatgtatgaagaccaggaatccagttatttttagtttccat
ccccgggctatgaagtgtagtattgaagcagcccggatcttgaaggaagctgctattaag
gccggtgctcctgagaattgcattagctggattgaagaaccatctattgaggctaccaac
tatttaatgaaacatcctgaggtggatttaattctggctaccggtggttctggaatggta
aaagcagcctattccagtggcaaaccagctctgggggttggacccggtaatgttccctgc
tatatagaaaagacagccaatataaagcaggccgtatctgaccttattttgagtaaaacc
tttgataatggtatgatctgtgcctctgaacaggctgtagtcgttgataaagaaattgct
gctgaggttaaaaagttcatgcaggaaaatggttgttattttgtcagtaaaaaggagtca
gaaaaactggccagagtggcagtggaccaggaaaggggtgccatgaatccggctgtagtc
ggtcaacctgcccgtaaaattgccaagatggccggcattaaagtgcctgatgacaccaaa
atcctggtagcagaacttaagggagttggagagaattaccccctgtcccgggaaaaatta
agcccgattctcggctggtatgttgtcaaagactatcgtgaaggaataaaacggtgtgaa
gagataacagaatttggaggacttggacattcttctgtgcttcacagtaatgatgaaaaa
gtaattgatgaattcagtcggagattgaggaccggtagattaattattaattcaccttca
tcccagggagcaataggagatatgtataactttaatgtcccttccctgaccctgggttgt
ggttctatgggtaaaaactcaacaaccgataatgtcaatgttgataatttaattaataag
aagagggtagccatgagaaaggaaaggatgaaatgggttaaagttcctcccaggatatat
tttgaatatggttcccttcgctatctgtcaggagttagaggtgagagggcctttataatt
actgataagactatgtcccagcttggttttattgataaggttgaagaacatctatctgta
gccggtgtccagaccagggtatttgacagtgttgagcctgatccatcagtagaaacggta
ttaaatggttgccaggagatgaatgaatttaaacctgatatcatcattgccctgggtggg
ggttccccgatggatgctgctaaaggtatgtggctattctatgaacacccggaaaccagg
tttgaagatctgaagatgaagtttaatgatattagaaaaagggtttataaattccccagg
ctgggtaaaaaggctacttttattgcagtacctacaacatcaggaaccggttctgaggta
accgccttttcagtaataactgataagaaacgtaatattaagtatccactggctgattat
gaacttacccctgatattgctataattgatccagaactggtcctgacagttccccagtca
gtaacagcagatacaggactggatgttttgacccatgctattgaggcctatgtttcggtt
atggcttctgattacactgatgccctggctgaaaaggctatcaagctggtatttgaatat
ctcccccgggcttataagaatggtaatgaccgggaagcaagaaagaagatgcataatgct
tcctgtattgccggaatggcctttactaatgcattcctggggcttaaccacagtatggcc
catatactgggaggtaagtttcatatccctcacggccgggctaatgcaattttattgcca
catgttattagatataatgccgggaaaccaagtaagctggccagcttcccccagtatgat
tatcctcgggcaggagaaaggtatgctgaaatagccagaatactgggacttcccgcttcc
actacagaagaaggggttgaaagcctggttaaagccataacagacctgatgagagaatta
aatatccccctttctctggaagaagccggggtaaatcacaacaagttcgaaaaagaactc
gaagatatggctgatattgcccataatgaccagtgtactggaactaaccccagaatgccg
ctggtcaatgaaatcaaggagatctatcgtcaggcgtataaaggggtcagtattaaagat
aaaaagaaagtccgtaatgcttag

DBGET integrated database retrieval system