KEGG   Halothermothrix orenii: Hore_03210Help
Entry
Hore_03210        CDS       T00838                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
hor  Halothermothrix orenii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:hor00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hore_03210
   01230 Biosynthesis of amino acids
    Hore_03210
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hore_03210
   00030 Pentose phosphate pathway
    Hore_03210
   00051 Fructose and mannose metabolism
    Hore_03210
   00052 Galactose metabolism
    Hore_03210
  Energy metabolism
   00680 Methane metabolism
    Hore_03210
Enzymes [BR:hor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Hore_03210
Protein phosphatases and associated proteins [BR:hor01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Hore_03210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
329307..330305
Genome map
AA seq 332 aa AA seqDB search
MKKIGVLTSGGDAPGMNAAIRSVVRTGIYHGLDVVGIRRGYAGLIEGDFYLMDRGSVADI
IQRGGTILLSARCEEFKTEEGRQKALKKMKEEGIEGLVVIGGDGSFRGAEKVSKELGIPA
IGIPGTIDNDLACTDFTIGFDTAMNTIIDTINKIRDTATSHERTFVVETMGRRSGFLTLM
AGLAGGAESILIPEIDFDLDDVSQKLKKGYERGKLHSIILVAEGVGDDFSTNRDINHSKA
FVIGKQIAEKTGLETRVIILGHIQRGGSPTAMDRILASRMGSKAVELLLASESNKMVGYV
NNKLVTCDISEALSKEKQVEKDVYKLANILSM
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaataggtgtattaacaagcggtggagatgccccgggaatgaatgctgccatc
aggtctgtggttagaactggtatatatcacggacttgatgttgttgggataagaaggggt
tatgccggtttaatcgaaggtgatttttatttaatggacaggggttctgtggccgatatt
attcaacgtgggggaactattctcctttcagcccgttgtgaagaatttaaaacagaagaa
ggccggcaaaaggcccttaaaaaaatgaaagaagaaggtattgaaggcctggttgttatt
ggtggtgacggctccttcaggggagcagaaaaagtaagcaaagagctgggtattcctgca
attggaattccgggtactatagataatgatctggcctgtactgattttactattggattt
gatactgccatgaatactattatcgatactatcaataaaatcagggatacggctacttcc
catgaaaggacctttgttgtagaaacaatgggacgcagatccgggtttttaacccttatg
gccggtctagccggtggtgccgaatccattttaatacctgaaattgactttgatctggat
gatgtttcccagaaattaaaaaaaggttatgaacgtggtaaactgcatagtattattctg
gtagctgaaggtgttggtgatgacttcagtaccaaccgtgatataaaccacagtaaggcc
tttgttattggcaagcagatagctgaaaaaacgggactcgaaacaagggtcattatcctt
ggtcatattcagaggggtggctctcctacagctatggaccggattctggcaagtcgaatg
gggtctaaagcggtagaattgctcctggctagtgaatctaataaaatggtaggatatgtt
aataataaacttgtaacctgtgatattagcgaagccctcagtaaggaaaaacaggtcgaa
aaagatgtatataagctagccaatattctttctatgtaa

DBGET integrated database retrieval system