KEGG   Halothermothrix orenii: Hore_04190Help
Entry
Hore_04190        CDS       T00838                                 

Definition
glycoside hydrolase family protein
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
hor  Halothermothrix orenii
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hor00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Hore_04190
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Hore_04190
Enzymes [BR:hor01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Hore_04190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
442073..443410
Genome map
AA seq 445 aa AA seqDB search
MNSISVILTARDTGDRLSLKGEKVFKSGIGRQDIDLELYPDTRYQKIIGFGGAFTEAAAY
TLSKISSDKRLKIIESYFDRDKGLGYNMGRVHINSCDFALENYTYVEDGDRELKTFDISR
ERQWVIPLIRDAIKARGGEIKLLASPWSPPAWMKSNENMNYGGKLLPEYRDVWAKYYTKY
IKAFQEEGLNIWGITVQNEPAAVQTWDSCTYTAEEERDFVKNHLGPVMHEEGLGDINILI
WDHNRDIIVDRVKPILDDLEAAKYVWGTAFHWYVSEDFDNVGQVHEMYPDKHLLFTEGCQ
EGGCQIGEWFTGERYGRNIIGDLNNWTEGYLDWNMVLNEEGGPNHVGNYCDAPVIVDTNT
EEIYYNSSYYYIGHFSKYIRPGAVRIGVSCTNDNLKATSFLNSDGSIILIVMNETDNPTD
FAVSLDNKVADLTLPAHAIATYIIT
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgaattctattagtgtaattttaaccgccagagacaccggagatagattaagtttaaaa
ggtgaaaaagtatttaaatcgggaatagggagacaggatatagacctggaattatatcct
gatacaagatatcagaaaataatcggttttggtggggcatttactgaggccgctgcatat
acactgtctaaaataagttctgataagagacttaaaattatcgaaagctattttgatagg
gataaaggtctcgggtataatatggggcgtgttcatatcaatagctgcgattttgccctg
gagaactatacttatgtagaagatggagatagagagttaaagacatttgatatttcccgg
gaacggcaatgggtgatacctttgatcagggatgctataaaggccaggggtggtgaaata
aaattactggcctcaccctggagcccacccgcctggatgaagagcaatgaaaatatgaat
tatggcggtaaattgctgcctgaatatagagatgtctgggctaaatattatactaaatat
attaaagcctttcaggaagaaggattaaatatctggggaattactgttcagaatgaacct
gcagcagttcagacctgggattcctgtacatatactgctgaagaagagcgtgattttgtt
aaaaaccacctcggcccggttatgcatgaagaaggccttggtgacattaatatccttatc
tgggatcataatagagatattattgttgacagagtaaaacccattctggatgaccttgaa
gctgctaaatatgtatgggggaccgcctttcactggtatgtgagtgaagactttgataat
gtgggccaggtacatgaaatgtatcctgacaagcatttgctttttactgaaggttgtcag
gagggtggctgtcaaattggcgaatggtttacgggtgagagatatgggcgtaatatcatc
ggtgatttaaataactggactgaagggtatctggactggaacatggtattgaatgaggaa
ggtggtccaaaccatgtgggcaattactgtgatgccccggtaattgtggatacaaataca
gaagagatatattataatagttcatattattatattggccatttcagtaaatatatcagg
cctggtgctgtccggattggtgtatcctgtactaatgataatttaaaggcaacatctttc
cttaatagtgatggtagtattatactaattgttatgaatgagacagataatcccacagat
tttgcagtatctcttgataataaggtagctgaccttacattgccagcccatgctattgca
acttatatcattacttaa

DBGET integrated database retrieval system