KEGG   Halothermothrix orenii: Hore_04430Help
Entry
Hore_04430        CDS       T00838                                 

Definition
DNA adenine methylase (EC:2.1.1.72)
Orthology
K06223  
DNA adenine methylase [EC:2.1.1.72]
Organism
hor  Halothermothrix orenii
Pathway
Mismatch repair
Brite
KEGG Orthology (KO) [BR:hor00001]
 Genetic Information Processing
  Replication and repair
   03430 Mismatch repair
    Hore_04430
Enzymes [BR:hor01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.72  site-specific DNA-methyltransferase (adenine-specific)
     Hore_04430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(475626..476546)
Genome map
AA seq 306 aa AA seqDB search
MNLPCEANTTRKTTKYAKPFVKWAGGKRQLIPDLFNSLPDNIERYFEPFVGAGALFFELA
NNNVISGRKSIIVDLNDDLINAYKVIKNSVESLINELKKHEKNNNEIYYYKVRGLWTRKA
RELGLSRKELWSVNELNNIQKAARFIYLNKTCYNGLYRLNNKGQFNVPYGNYKNPRICDE
DNLRTVSQLLQNVTIIKNDFEIIKDKYRFTPADFVYFDPPYVPLSDTSNFTSYTKNGFTK
EDQERLYELFNYIDMQGGKCMLSNSNSPLIKKLYSKFNIKEVKAIRAINCIGNKRGAIKE
LIITNY
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaacttaccatgtgaggcaaatacaacccggaaaacaacaaaatatgcaaagccattt
gtaaaatgggccggaggaaaaagacaacttattcctgatttatttaattcattacctgat
aatattgaaagatactttgagccctttgtaggtgccggagctcttttttttgaattagca
aataacaatgtaatatccggaagaaaaagtattatagtagaccttaatgatgatctgata
aatgcatataaagttataaaaaattctgttgaatctcttattaatgaattaaaaaaacat
gaaaaaaataataatgaaatatattattataaagttagaggactatggacgcgaaaggcc
agagagttaggtctatccaggaaagaactatggagtgtaaatgagcttaacaatatccag
aaagcagccagatttatatatcttaataaaacctgctacaatggtttataccgtttgaat
aataaaggtcaatttaatgtaccttatggtaattataaaaatcccaggatatgtgatgaa
gataatctaaggactgttagccaattattacaaaacgttacaataattaaaaacgatttt
gaaataataaaagataagtatagatttacaccggccgattttgtttactttgatcctccc
tatgtacccttgtcagatacttctaattttacttcttatacaaaaaatgggtttactaaa
gaagatcaggaaaggttatacgaattattcaattatatcgatatgcagggtgggaaatgc
atgttaagcaattcaaactctccattgataaaaaaactatattcaaaattcaatattaaa
gaagttaaagcaattagagctataaattgtattggaaacaaacggggagcaataaaagaa
ttaataataactaactattaa

DBGET integrated database retrieval system