KEGG   Halothermothrix orenii: Hore_04580Help
Entry
Hore_04580        CDS       T00838                                 

Definition
Ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
hor  Halothermothrix orenii
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:hor00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Hore_04580
Enzymes [BR:hor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Hore_04580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
491274..492194
Genome map
AA seq 306 aa AA seqDB search
MTKEILVIGSLNMDLIVQTEKYPRKGETVPGENFKQVPGGKGANQALTAGKLGGQVRFIG
SCGKDEYGTTLLNNLKNGGVIVDDILRVEKNTGIAMITIEKEGSNRIIYVKGANEYVTPD
VVMKMEDRFKKASILLIQMEIPLESVIKAVELAKKYQMKVILDPSPVQGLPEKIFPLIDY
ILPNEIELDELVKNGCQIEEEKAKHLLKLGTNNVIVTKGKNGVSHYYEDKVATYESYHVK
AVDTTAAGDAFAGSLAYGLSQGWSLEKTIKFSNLVAANSVTKLGAQSSLPTYQEVMKFAK
HIKKNI
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaggagattcttgtaataggtagtttaaacatggatttaattgtccaaactgaa
aaatacccacgtaaaggtgaaacagtaccgggagaaaattttaaacaggtacctggaggt
aagggtgctaatcaggctttaactgctggtaagctgggtggtcaagtaaggtttattggt
tcctgtgggaaggatgagtatggtacaacacttttaaataatttgaaaaatggtggagtt
attgtagacgacattctcagggttgaaaaaaacacaggtattgccatgatcacgatagaa
aaagaggggtctaacaggattatctatgttaaaggggccaatgaatatgttacacctgat
gttgtaatgaaaatggaagatagatttaaaaaagcatcaattcttttgattcaaatggag
attcccctggaatcagttattaaggctgttgaattggctaaaaaatatcagatgaaagtt
attcttgatccatcacctgtacaggggctcccggaaaaaatttttcctcttatagattat
atactaccaaatgaaattgaattggatgagttagtaaaaaatggatgtcaaattgaagaa
gagaaagcaaagcacctcctgaaacttggcacaaataatgtaattgtaacaaaagggaag
aacggggtttcccattattatgaagataaggttgcaacatatgaaagctaccatgttaaa
gcggtagatacaactgctgccggtgatgcctttgctggatcattagcttatggtctaagc
cagggatggtcactggaaaaaacaattaaatttagtaacctggttgctgctaactctgta
acaaaactgggagcccagagctcacttcctacatatcaagaagttatgaaatttgcgaaa
catataaaaaaaaatatatag

DBGET integrated database retrieval system