KEGG   Halothermothrix orenii: Hore_06930Help
Entry
Hore_06930        CDS       T00838                                 

Definition
1,4-alpha-glucan-branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
hor  Halothermothrix orenii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:hor00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(749779..751671)
Genome map
AA seq 630 aa AA seqDB search
MKDKIPTDYDRYLFHQGSHYKSYEFLGAHPCEENGKTGVRFSVWAPNAAEVRVIGSFNNW
DGNINPMERINDSGIWTTFIPEAKKGDLYKYEILTKYGDTRIKSDPYAFYAERKPKTASI
VYSLNNYKWNDKKWMDKKKDYTVYNKPVLIYEVHLGSWKRKENGDYLTYRELANELVEYV
KDMGYNYIELLPVAEHPFDGSWGYQLTNYYSVTSRYGTPEDFMYFIDKCHQNGIGVILDW
VPGHFCKDDHGLRLFDGTALYEPQDPRKAENEWDTLNFDFNQPEVWSFLISNAVFWFDIY
HIDGLRVDAVSNLLYLNHGKGDGEWVPNKYGGHENLEAIDFIKTLNKVIFEYFPNPLMIA
EESSAWPLVTYPAHLGGLGFNYKWNMGWMNDTLEYMEMDSIYRKYHHNLLTFSFMYMFSE
NFVLPLSHDEVVHGKKSLLDKMPGDYWQKFANLRTLYGYMMGHPGKKLLFMGGEFGQFIE
WNYKQGLDWLLLDYDMHKKLQNYVRELNYFYRQEKTLWEGDHEDGGFEWIDPHDSEQSII
TFMRKNKDGSDYTIIVCNFTPEVRHNYRIGVPEFKEYKEVFNSDLEKFGGSGQKNSTIIQ
PSEQPWHNRPYSIEITIPPLATIFFKPLNQ
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagataaaataccgactgattatgaccgatatttatttcaccagggaagccactat
aaaagctatgaatttttaggagctcacccctgcgaagaaaatggaaaaacaggggttcgt
ttttcagtctgggcccctaacgctgccgaagtcagggttattggcagtttcaataattgg
gatggtaatataaatcccatggaaagaattaatgattctggaatatggactaccttcata
cctgaggccaaaaagggagatctttataaatatgaaatattaacaaaatatggagatacc
agaataaagtctgatccttatgccttttatgctgaacgcaaaccaaaaactgcctcaatt
gtttactcccttaataattacaagtggaatgataaaaaatggatggacaagaaaaaagat
tatacagtgtataataaaccggtcttaatatatgaagtccacctcgggtcctggaaacgt
aaggaaaatggggattatctaacctaccgggaactggcaaatgagcttgtcgaatatgtc
aaagatatggggtataactacattgaattgttaccggttgcagaacacccctttgacggt
tcctggggttatcagttaaccaactactattctgttacgagtcgttatgggacacctgaa
gattttatgtattttatcgacaaatgtcaccagaatggtatcggggttatcctggactgg
gtacccgggcatttctgcaaagatgaccatggactaaggttatttgatggaactgccctt
tatgaaccccaggatccccggaaggctgaaaatgaatgggatactttaaactttgatttt
aaccagccagaagtatggagtttccttatctctaatgcagttttctggtttgatatctac
catatcgacggactcagggttgatgctgtaagtaaccttttatatttaaaccatggaaaa
ggtgacggggaatgggtccccaacaaatatggtggccatgaaaacctggaagctattgat
tttataaaaacccttaataaagtaatttttgagtatttccccaatcccctgatgattgct
gaagaatccagcgcctggcccctggtaacttacccagctcatcttggtggtctcggtttt
aattataagtggaatatgggatggatgaatgataccctggaatacatggaaatggattct
atatatcgtaaataccatcataacctcctgaccttctcttttatgtacatgttttcagaa
aactttgttttacctctatcccatgatgaagtagttcatggaaaaaaatctttacttgat
aaaatgcccggtgattactggcagaaatttgctaatttaagaaccctttatggatatatg
atgggacaccccggtaaaaaattattatttatgggtggagaatttggacaatttatcgag
tggaactataaacagggacttgactggctattactcgattatgatatgcataaaaaactc
cagaattatgtcagggaattaaactacttctatagacaggaaaaaaccctgtgggaaggg
gatcatgaagatgggggatttgaatggattgatccccatgacagtgaacagagtatcatt
acatttatgagaaaaaacaaagatggaagtgactatactattattgtctgtaattttact
cctgaagtcagacataattacagaattggtgttcctgagtttaaagaatataaggaggta
tttaatagtgacctggaaaaattcggtgggtccggccagaaaaattctacaattatacag
ccaagtgaacaaccatggcataacagaccatattcaatagaaataacaatacctcctctg
gcaacaatattttttaaacccctgaatcaataa

DBGET integrated database retrieval system