KEGG   Halothermothrix orenii: Hore_08030Help
Entry
Hore_08030        CDS       T00838                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hor  Halothermothrix orenii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hor00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Hore_08030
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hore_08030
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Hore_08030
Enzymes [BR:hor01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Hore_08030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
862764..863819
Genome map
AA seq 351 aa AA seqDB search
MKKWPGIIEAYREFMPLKETTKPVTLQEGNTPLIYADRLSEKLGIQLYLKYDGANPTGSF
KDRGMTLAVTKAIEDGSEAIMCASTGNTSAAAAAYGARSGLKTAVVIPEGKIALGKLAQA
LMHGAEVIPIKGNFDDALAIVKEITSKYPITLVNSLNPYRIEGQKSGAFEVCDQLGNAPD
VLAIPVGNAGNITAYWKGFKEYYRAKKIESLPRMLGFEAEGSAAIAKNTVISEPETIATA
IRIGNPASWDKAVKAAEESRGLIDYVTDNEIIETYREIASEVGIFAEPASAASVAGVKKM
VARSVIKPGSQVVAVLTGHGLKDPTTAIDTIKKPEPVSAEVEAVLEKMGTW
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatggcctggaataattgaagcttatagagaatttatgccccttaaggaaaca
acaaaaccggtaaccctgcaggagggaaatacccctttaatatatgctgacaggttaagt
gaaaaacttggtattcaactatacttaaaatatgatggagccaatccaactggttctttt
aaagataggggtatgactctggctgtaactaaagctatagaagatggatcagaggctatt
atgtgtgcatcaacaggtaatacttctgcagcagcagcagcctatggggccagaagtggc
cttaagacagctgtagttattcctgaaggaaagatagccctggggaaactggcccaggcc
ttaatgcatggggctgaggtaatacctatcaagggaaattttgatgatgccctggctata
gttaaggagattaccagtaaatatcccataacacttgttaattctttaaatccataccgg
atagaaggccagaaaagtggtgcctttgaggtctgtgatcaactcggaaacgcccctgat
gttctggctataccggttggtaatgccggaaatataactgcctactggaagggttttaaa
gaatattaccgggctaaaaagatagagtcattgccccgtatgcttggttttgaagctgaa
ggttcagcagccatagctaaaaatactgtaatcagtgaaccggaaacaattgctactgca
ataagaatcggtaatccagccagctgggataaagctgttaaagctgctgaagaatcccgg
ggtcttattgattatgtaacagataatgagattattgagacctacagggaaattgcctca
gaggttggtatatttgctgagccggcgtcggccgcttcagtggcaggggttaaaaaaatg
gtggcccggagtgtgatcaagcccgggagtcaggttgtggctgtcttaaccggtcacggg
cttaaagacccaaccactgcaattgataccatcaaaaaaccagaacctgtttccgcagag
gtagaggcggttcttgagaaaatgggaacatggtag

DBGET integrated database retrieval system