KEGG   Halothermothrix orenii: Hore_08090Help
Entry
Hore_08090        CDS       T00838                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
hor  Halothermothrix orenii
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hor00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Hore_08090
Enzymes [BR:hor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Hore_08090
Exosome [BR:hor04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Hore_08090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
868990..870489
Genome map
AA seq 499 aa AA seqDB search
MNKKYIMAIDQGTTSTRAMIFNHRGEVVSKSQQEFSQIYPKPGWVEHSPDEIWVSILGVM
SGALRSKGISPKEIAAIGITNQRETTVIWDKNTDEPVYNAIVWQCRRTTDICQELKNNGL
EDKFKEKTGLVLDPYFSGTKIKWILDNVAGARQKAKNGDLLFGTIDSWLIWKLTGGKVHV
TDYTNASRTLLYNIHELDWDEELLDILGIPESILPEVKASSTIYGNTVPYHFFGEEVPIS
GIAGDQQAATFAQGCYEKGMTKITYGTGGFMLMNTGKEAVTSDNGLLTTIAWGLDDGIYY
ALEGSIFNAGSAIQWLRDELDLIEDAADSEYFASKVEDTGGVYVVPAFTGLGAPYWDPRA
RGIIVGLTRGTNKNHLIRATIESLIYQSKDVLMAMVEDSGLDLKDIKVDGGAAANNLLLQ
FLSDMTGSRVERPINTETTAAGAAYLAGLAIDFWTDQEEVLKIRKVDREFNPDMSGEKRE
QLYRGWKKAINAALSWSKT
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
gtgaataaaaagtatataatggccattgatcaggggacaaccagtaccagagctatgata
tttaatcaccggggtgaggttgtcagtaagtcacagcaggaatttagtcagatataccct
aaaccgggctgggttgaacacagtcctgatgagatctgggtttcgatccttggtgtcatg
agtggcgccttaaggtcaaaaggtatttcacccaaagaaattgctgccattggaattaca
aatcagcgagagactacagtaatctgggataaaaatacagatgaacctgtctataatgct
attgtctggcagtgtcggagaactacagatatctgtcaggaattaaaaaataatgggctg
gaagataaatttaaagaaaaaacgggtcttgtccttgacccttacttttcagggaccaaa
attaagtggattttagacaatgttgccggagccaggcagaaagctaaaaatggtgacctt
ctgtttggcacaattgatagctggttgatatggaagcttaccgggggaaaagtccatgtc
actgattatactaatgcatcccggactttattatataacattcatgagttagactgggat
gaagaattattagatatccttggtattccagagagtatacttcctgaagttaaagcgagt
tcgacaatttacggtaatacagtaccctatcattttttcggagaggaggttcctatttct
ggtattgccggggaccagcaggctgctacctttgcccagggttgttatgaaaaggggatg
actaaaattacctatggtaccggtggatttatgttaatgaataccggaaaagaagcggtt
acttcagataatggactgttaacaacaattgcctggggcctggatgatggtatatattat
gcccttgagggaagtatttttaacgccggttccgcgattcagtggctaagggatgaactt
gacttaattgaagatgctgctgattctgagtattttgccagtaaggtagaagataccgga
ggtgtctatgttgttcctgcttttacaggactcggtgccccttactgggatcccagggcc
cgggggataattgtaggtctaaccaggggaactaataaaaatcatcttatccgggccact
attgagtcactgatttatcagagtaaagatgttttaatggcaatggttgaagattcgggt
cttgatttaaaggatataaaggttgatggaggtgctgctgctaataatcttttgttacag
ttcctatcagatatgaccggatcccgggttgaaagacccattaacactgaaacgacggca
gccggggcagcttatctggctggtctggctattgatttctggacagaccaggaggaagta
cttaagataaggaaagttgaccgggagtttaatcctgatatgtcaggggaaaaaagagag
caattatacaggggatggaaaaaagctattaatgcagcccttagctggagtaagacttaa

DBGET integrated database retrieval system