KEGG   Halothermothrix orenii: Hore_08180Help
Entry
Hore_08180        CDS       T00838                                 

Definition
carboxylesterase (EC:3.1.1.1)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
hor  Halothermothrix orenii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(880508..881308)
Genome map
AA seq 266 aa AA seqDB search
MKDLNLNPDTQVNPIARERFYSGSKEDAVLVIHGFTGIPAEMEYLGKEINKKTGYTVYIP
RLPGHGTNRQDFLTSGARDWLRKIYDSYLNLKADYKNVHLAGLSMGGLLALLTAARFNHS
AKLILIAAALYANHPLLPYSHIIKFFKKEIKNDPEVLQLDEEGLTPEDKLYREHYWGYTF
PVQGAELHKLMRLTRKKLPQISCNTLIIASKKDDTVPLKAAYTIKNNIKSKQKKLVILEN
SPHVINDGPEKDKCARIVTDFLLKTI
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaaggacttaaatttaaatccagatacacaggttaatcccatagcccgggaaagattt
tattctggttcaaaagaagatgctgttcttgttattcatggttttaccggtatacccgct
gaaatggagtatctgggaaaagagattaataaaaagaccggttatacagtttacataccg
cggcttccaggccatggcactaatcggcaggattttttaaccagtggggcccgggactgg
ctccgtaaaatttacgatagttaccttaatttaaaagctgactataagaatgtccacctg
gctggcctctcaatgggaggattgttagctttattaactgccgccagatttaatcattct
gctaaacttattctgattgcagcagctctttacgctaaccaccctcttttaccctatagt
catatcataaaattttttaagaaagaaattaagaatgatcctgaagtattacagctggac
gaagagggtctaacccctgaagacaaactataccgtgaacactactggggatacaccttc
ccggtccagggggcagaattacataaattaatgaggcttacccgtaaaaaactcccccag
atatcctgtaataccctgattattgcatcaaaaaaagatgatactgtaccattaaaagca
gcctataccataaaaaataatataaagtcaaaacaaaaaaaactggtcattttggaaaat
tcccctcatgtaataaatgatggaccagaaaaagataaatgtgccagaattgttacagat
tttttattaaaaactatttaa

DBGET integrated database retrieval system