KEGG   Halothermothrix orenii: Hore_08190Help
Entry
Hore_08190        CDS       T00838                                 

Definition
Xaa-His dipeptidase (EC:3.4.13.3)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
hor  Halothermothrix orenii
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hor01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:hor00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
881660..883054
Genome map
AA seq 464 aa AA seqDB search
MRSEVNSKIDSLKEDIIKSTQELVKIRSVEEKGQEGKPFGEGVSDALEKALEIGRNLGLK
TGNVDGYAGFIEIGCGKEMVGILCHLDVVPEGSGWTYPPYGAEIHNNKIYGRGTLDNKGP
AVAALYAMKAVNDLGFDLNKRVRLILGTDEESGWEGLKYYLEKEEIPDSAFSPDAEYPVI
LGEKGILNIKIKSLFNNENNSGLVSIKGGNAPNMVPDYCEAVFDIVVNHDEIVSKLNEFK
ERTGFKLEVEKSGESLIIKSYGKSAHGSLPEDGHNAISQLMVFLSDMISTDDALGKFIKF
YKERIGMEYYGESIGCHLRDDVSGPLTFNVGMVNINQNSGEIIVNIRYPVTLSRDKVLNG
IKQIIDQTEFRLEEMEHMEPLYVPKNDPLVQKLMKVYREFTGDDRDPITIGGGTYARAVE
KAVAFGPIFPGQPELAHQKDEYIDIDDLIKNAKIYANAIIELAT
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
gtgaggtcagaagttaacagtaaaatagatagtttaaaggaagatattataaaatcaacc
caggaattagttaaaatcagaagtgttgaggaaaagggacaggaaggtaaaccttttggt
gaaggggtcagtgatgccctggaaaaagccctggagattggcagaaatttagggttgaag
acaggaaacgtagacgggtatgctggttttatagaaataggttgtggtaaagaaatggtt
ggaatcctttgccaccttgatgtagttcctgaaggtagtggctggacttaccctccctat
ggtgctgagatacataataataaaatttatggccggggtactctagataataaaggaccg
gctgttgccgccctatatgccatgaaagcggttaatgatctcggttttgatttaaataag
agggtcagattgatactggggacagatgaagagagtggctgggaaggtttaaaatactat
ctggaaaaagaagaaatacctgattcagccttcagccccgatgctgagtatcctgttatt
cttggagaaaagggtatactgaacataaaaattaaatccttatttaataatgaaaataat
agtggtttagtatctattaaagggggaaatgcccccaatatggttcctgattattgtgaa
gcagtatttgatattgttgttaaccatgatgaaattgttagtaaactcaatgaatttaaa
gagaggaccgggtttaaattagaggttgaaaagtccggggagagtcttataataaaatct
tacggaaaatcagcccatggtagcctgccagaagacggtcataatgctatctcacagctt
atggtgtttctttcagatatgatatcaactgatgatgctctgggcaaatttattaagttt
tataaggagagaattggaatggagtattacggggaatcgatcggttgccatttacgtgat
gatgtctcaggaccactaacctttaatgtgggtatggttaatattaatcaaaattctgga
gaaattatagtaaacatccgttatcccgtgactctctccagagataaagttttaaatggt
attaaacaaataattgatcagactgagtttagactggaagagatggaacatatggaaccg
ctatatgtacccaagaatgatcccctggtacagaaattgatgaaggtgtatcgagaattt
accggggatgacagggacccaataacaataggtgggggaacttatgccagggctgttgag
aaagctgtagcttttggccccatattcccgggacagcctgaattggctcatcaaaaggat
gaatatatagatattgacgacctcataaagaatgccaaaatctatgccaatgcaatcatt
gaactggccacataa

DBGET integrated database retrieval system