KEGG   Halothermothrix orenii: Hore_08190Help
Entry
Hore_08190        CDS       T00838                                 

Definition
Xaa-His dipeptidase (EC:3.4.13.3)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
hor  Halothermothrix orenii
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hor00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Hore_08190
  Amino acid metabolism
   00300 Lysine biosynthesis
    Hore_08190
Enzymes [BR:hor01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Hore_08190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
881660..883054
Genome map
AA seq 464 aa AA seqDB search
MRSEVNSKIDSLKEDIIKSTQELVKIRSVEEKGQEGKPFGEGVSDALEKALEIGRNLGLK
TGNVDGYAGFIEIGCGKEMVGILCHLDVVPEGSGWTYPPYGAEIHNNKIYGRGTLDNKGP
AVAALYAMKAVNDLGFDLNKRVRLILGTDEESGWEGLKYYLEKEEIPDSAFSPDAEYPVI
LGEKGILNIKIKSLFNNENNSGLVSIKGGNAPNMVPDYCEAVFDIVVNHDEIVSKLNEFK
ERTGFKLEVEKSGESLIIKSYGKSAHGSLPEDGHNAISQLMVFLSDMISTDDALGKFIKF
YKERIGMEYYGESIGCHLRDDVSGPLTFNVGMVNINQNSGEIIVNIRYPVTLSRDKVLNG
IKQIIDQTEFRLEEMEHMEPLYVPKNDPLVQKLMKVYREFTGDDRDPITIGGGTYARAVE
KAVAFGPIFPGQPELAHQKDEYIDIDDLIKNAKIYANAIIELAT
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
gtgaggtcagaagttaacagtaaaatagatagtttaaaggaagatattataaaatcaacc
caggaattagttaaaatcagaagtgttgaggaaaagggacaggaaggtaaaccttttggt
gaaggggtcagtgatgccctggaaaaagccctggagattggcagaaatttagggttgaag
acaggaaacgtagacgggtatgctggttttatagaaataggttgtggtaaagaaatggtt
ggaatcctttgccaccttgatgtagttcctgaaggtagtggctggacttaccctccctat
ggtgctgagatacataataataaaatttatggccggggtactctagataataaaggaccg
gctgttgccgccctatatgccatgaaagcggttaatgatctcggttttgatttaaataag
agggtcagattgatactggggacagatgaagagagtggctgggaaggtttaaaatactat
ctggaaaaagaagaaatacctgattcagccttcagccccgatgctgagtatcctgttatt
cttggagaaaagggtatactgaacataaaaattaaatccttatttaataatgaaaataat
agtggtttagtatctattaaagggggaaatgcccccaatatggttcctgattattgtgaa
gcagtatttgatattgttgttaaccatgatgaaattgttagtaaactcaatgaatttaaa
gagaggaccgggtttaaattagaggttgaaaagtccggggagagtcttataataaaatct
tacggaaaatcagcccatggtagcctgccagaagacggtcataatgctatctcacagctt
atggtgtttctttcagatatgatatcaactgatgatgctctgggcaaatttattaagttt
tataaggagagaattggaatggagtattacggggaatcgatcggttgccatttacgtgat
gatgtctcaggaccactaacctttaatgtgggtatggttaatattaatcaaaattctgga
gaaattatagtaaacatccgttatcccgtgactctctccagagataaagttttaaatggt
attaaacaaataattgatcagactgagtttagactggaagagatggaacatatggaaccg
ctatatgtacccaagaatgatcccctggtacagaaattgatgaaggtgtatcgagaattt
accggggatgacagggacccaataacaataggtgggggaacttatgccagggctgttgag
aaagctgtagcttttggccccatattcccgggacagcctgaattggctcatcaaaaggat
gaatatatagatattgacgacctcataaagaatgccaaaatctatgccaatgcaatcatt
gaactggccacataa

DBGET integrated database retrieval system