KEGG   Halothermothrix orenii: Hore_08830Help
Entry
Hore_08830        CDS       T00838                                 

Definition
(GenBank) stationary-phase survival protein SurE
  KO
K03787  5'-nucleotidase [EC:3.1.3.5]
Organism
hor  Halothermothrix orenii
Pathway
hor00230  Purine metabolism
hor00240  Pyrimidine metabolism
hor00760  Nicotinate and nicotinamide metabolism
hor01100  Metabolic pathways
hor01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hor00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Hore_08830
   00240 Pyrimidine metabolism
    Hore_08830
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Hore_08830
Enzymes [BR:hor01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     Hore_08830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SurE
Motif
Other DBs
NCBI-ProteinID: ACL69639
JGI: Hore0883
UniProt: B8CWH0
Position
951079..951846
Genome map
AA seq 255 aa AA seqDB search
MNVLLTNDDGVYAEGIFILASYLVSAGHRVVVSAPDRERSATGHAITISYPLRAYKIKLN
IKGEIDVYKIDGTPADCVKLGVEKLAGFKPDIIISGINDGPNLGYDVLYSGTVSAAIEGW
MMGYTSIAVSLNSNGQYHFKTGADFIVRLLNNFDFLSLDQKMLLNINIPDLPGEKINGIK
ITKLGKSLYEDSFEKRFDPMGKPYYWLTGNNVDNNIHDSTDIWAIKNNYISITPLKIDLT
DLSQIDILNHNLNNL
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtactattaaccaatgatgatggtgtttatgctgaagggatatttatactcgcc
agttatttagtttctgcaggccatcgggttgttgtgtctgcacctgacagagaacgtagt
gctaccggtcatgcaataacaattagttatcctttacgggcctataagattaaattaaat
ataaaaggtgaaattgatgtatataaaattgatggaaccccggccgattgtgtgaagcta
ggtgttgaaaaactggcaggatttaaaccagatataataatttcaggtattaatgatggc
cctaatcttggttatgatgttctatattcgggtactgtatctgctgctattgaagggtgg
atgatgggatatacctctattgctgtctcccttaatagtaacggacaatatcatttcaaa
acaggggctgactttattgtaaggttattaaataattttgattttttatctctggatcaa
aaaatgttgttaaacatcaatattcccgatttacctggtgaaaaaattaatggaattaaa
ataacaaaattgggtaaaagcctttatgaagatagttttgaaaaaagatttgatcccatg
ggaaaaccgtattactggctaacaggaaataatgttgataataatatacatgatagtacc
gatatctgggcgattaaaaacaattatatttctataacaccattaaaaatagatttaact
gatttatctcagatagatattcttaatcataacctgaataacctataa

DBGET integrated database retrieval system