KEGG   Halothermothrix orenii: Hore_09370Help
Entry
Hore_09370        CDS       T00838                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
hor  Halothermothrix orenii
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hor00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Hore_09370
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Hore_09370
Enzymes [BR:hor01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Hore_09370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1010401..1011342
Genome map
AA seq 313 aa AA seqDB search
MALKRKDFLGLYNVEADEINEILDTAQAMKEIFTRTVKKVPTLRGKTIINLFFEPSTRTK
SSFDIAAKRLSADVMSISKSSSSVAKGETLLDTARTLEVMGADVVVVRHSAPGAARFLAE
NLSASVLNAGDGAHAHPTQALLDMYTIKEKMGKIEGLNVLIIGDIAHSRVARSNIWGLTK
LGARVRVVGPGTLIPRDIEEMGVEVYRDLDEALEGVDVVNILRIQLERQQKGLFPSIREY
RHFYGMNEVRLRKLEDRALVMHPGPMNRGIEIESIVADGEQSVITEQVTNGVAIRMALLY
LLAGREINDEDLA
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggctttgaaaagaaaagattttcttggtttatacaatgtagaggcagatgaaataaat
gaaatactggatacggcccaggccatgaaggaaatttttacaagaacagtaaaaaaagtc
ccgacccttaggggtaaaactattataaatctgttttttgagccgagtacccggaccaag
tcatcttttgatatagctgccaagaggctcagtgctgatgttatgagtatttcaaaatct
tccagcagtgtggccaagggagagactttacttgatacagcccggacccttgaagttatg
ggagctgatgttgtggttgtcaggcacagtgccccgggggcagcccggtttctggcagaa
aacctttcagccagtgtcctcaatgccggggatggagctcatgctcatccaacccaggct
ttactggatatgtatactattaaggaaaagatggggaaaatagaaggtttgaatgtttta
attatcggggatatagcccacagcagggtggcccggtccaatatctgggggttaactaaa
ctgggggccagggttcgcgttgttggacctggtacccttatccccagggatatagaggag
atgggggttgaggtataccgtgaccttgatgaagcccttgaaggtgtggatgttgtaaac
attttaagaatacagctggaaagacagcaaaaaggtttgttcccttccatcagggaatac
aggcatttttacggaatgaatgaagtaagactaaggaaactggaagatagagcattggtt
atgcatcctggtcccatgaacaggggtatagagattgaaagtattgttgccgatggggaa
caatctgtcatcactgaacaggttactaacggggttgctataagaatggctttattatac
ttactggccgggagggagataaatgatgaggaccttgcttaa

DBGET integrated database retrieval system