KEGG   Halothermothrix orenii: Hore_09570Help
Entry
Hore_09570        CDS       T00838                                 

Gene name
fucI
Definition
L-fucose isomerase (EC:5.3.1.25)
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
hor  Halothermothrix orenii
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hor00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Hore_09570 (fucI)
Enzymes [BR:hor01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.25  L-fucose isomerase
     Hore_09570 (fucI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1033962..1035773
Genome map
AA seq 603 aa AA seqDB search
MSNKTNLKINKQHRLRGNLPKIGIRPAIDGRRKGIRESLEGQTMGMAKAVANFLEENLKY
PNGTPVECVIADTCIGGVAEAAATAEKFSREGVGVSITVSPCWCYGSETMDMNPLIPKAI
WGFNGTERPGAVYLAALKAAHDQKGLPIFPIYGRQVQDADDRSIPEDVQEKMLRFAKAGL
AVAIMRGKSYLSMGSVSMGIAGSMVNEDFFQEYLGMRNEYVDMSEFIRRMEEEIYDKAEF
KRAMKWVKENCNEGKDNNPPQVQHSRETKDEEWETVVKMTLIARDLMVGNPKLAEMGYGE
EAMGHNAIAAGFQGQRQWTDHFPNGDFMEAILNSSFDWNGLREPFIMATENDTLNGVSML
FGHLLTNTAQIFADVRTYWSPESVKRVTDKELTGRAQNGIIHLINSGSATLDGTGQQTKN
GRPVMKPFWEISSEEVEACLEATSWRPAMLDYFRGGGFSSNYLTKGGMPLTMIRINIIKG
LGPVLQIAEGYSVDLPEDVHRILDQRTDPTWPTTWFAPILTGKGAFKDVYSVMNRWGANH
AAVSYGHIGGDLITLAAMLRIPVAMHNVSEDKIFRPSAWDGFGTNDLEGADYRACKTFGP
LYG
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaataaaacaaatttaaaaattaacaaacaacatcgcttaagaggtaatttacct
aaaatcggcataaggcctgctattgatggtcgtcgcaagggaattagagaatcattagaa
ggtcagacaatgggaatggctaaagctgtggctaattttttagaagaaaatctgaagtat
ccaaatggtacacctgtagaatgtgttattgctgatacttgtataggtggggtagcagaa
gcagctgctacggctgaaaagttttcacgagaaggtgttggagtttcgattacagtttca
ccatgctggtgttatggttcagaaacaatggatatgaatccattgataccaaaagccatc
tggggttttaatggtactgaaagacctggtgcagtttatttagctgctcttaaagcggca
catgatcagaaagggttacctattttccctatatatggacgtcaagttcaggatgctgat
gatagaagtattccagaagatgttcaggaaaaaatgctccggtttgccaaggctggatta
gctgtggctattatgcgtggtaagtcttatctgtctatgggttcagtttctatgggaatt
gcaggttctatggttaatgaagatttctttcaggagtatttgggtatgagaaatgaatat
gtagatatgtcagaatttataagaagaatggaagaagaaatttatgataaagctgaattt
aaaagagcaatgaagtgggtaaaagaaaattgtaatgaaggtaaagataacaatccccct
caagttcaacattctagagagacaaaagatgaagaatgggaaacagtagttaagatgact
ttaatagcaagagatttgatggttggtaatcccaaacttgctgaaatgggttatggagaa
gaggctatgggtcataatgctatagccgcaggttttcagggtcaaagacaatggactgat
cattttccaaatggtgactttatggaagctattttaaattcttcttttgactggaatgga
ctcagggagccatttattatggctactgagaatgatactttaaatggagtatcaatgtta
tttggtcatttattaactaatacagctcaaatatttgctgacgtaagaacttattggagt
ccagaatcagttaagagagtaactgataaggaattaactggtagagcccaaaatggtatt
atccatttaattaattcaggttcagcaacattagatgggaccggtcagcaaactaaaaat
ggtaggcctgtgatgaaacctttctgggaaattagttcagaagaagttgaagcttgtctt
gaagcgacttcatggcgacctgctatgttggattattttagaggaggaggattctcgtct
aattatttaactaaaggtggcatgccattaacaatgattagaataaatattattaaagga
ttgggaccggtcctccagattgctgaaggttattcagtagatttacctgaagacgttcat
agaattctggatcagagaactgatcctacctggcctactacatggtttgctcctatattg
acaggaaaaggtgcttttaaagatgtttattcagtaatgaatagatggggagcaaatcat
gcagctgtcagttatggtcatattggtggagatttaattactctagctgctatgcttaga
atccctgttgctatgcataatgtatcagaagataaaatttttaggccaagtgcctgggat
ggttttgggactaatgatttagagggagcagactatcgtgcatgcaagacttttggacct
ttatatgggtga

DBGET integrated database retrieval system