KEGG   Halothermothrix orenii: Hore_11310Help
Entry
Hore_11310        CDS       T00838                                 

Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hor  Halothermothrix orenii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hor00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Hore_11310
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hore_11310
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Hore_11310
Enzymes [BR:hor01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Hore_11310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1224857..1226053
Genome map
AA seq 398 aa AA seqDB search
MALDVRQLEDGFFGNFGGRYVPEKLVPVLEELKKAFLKYKDDENFNKELDYYLKEYVGRA
NPLYFAEKLSKKLNGARIYLKREDLNHTGAHKINNCIGQGLLAKRMGKNRIIAETGAGQH
GVATATACALLGMDCVIYMGEKDTKRQALNVFRMELLGAKVVPVKTGSRTLKDAVDEALK
DLIENYDNTFYMLGSAVGPDPYPTIVRHFQSVIGKEAKKQIIEKEGRLPDYIIACVGGGS
NAIGLFYPFIEDKEVNIIGVEPGGKGSEPGQNAAPLNFGEPGVLHGFMCYMLKDKKGNVA
STHSIAAGLDYPGVGPEHSYLKETGRARYTTINDEEALKAFNLLSQVEGIIPALESSHAV
AQAIKLAPELDKNQIIIVNLSGRGDKDVHQIAGLMDKI
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggctttagatgttagacaactggaagatggtttttttggtaattttggggggagatat
gttccggaaaaattagttccggttcttgaagaacttaaaaaggcatttttaaaatataag
gatgatgaaaattttaataaagagctggattactatttaaaagaatatgtagggagggct
aaccccctgtattttgctgaaaaattatcaaaaaaattaaatggggccagaatttattta
aagagggaagatttaaaccatactggtgctcataaaattaataattgtattggtcagggg
ttactggccaaaagaatgggtaaaaataggattattgctgaaactggagcaggtcaacat
ggggtggcaactgcaactgcctgtgctttactaggtatggactgtgttatttatatgggt
gaaaaagataccaaacggcaggccttaaatgtattcaggatggagctgttgggggctaag
gttgtccctgttaagacgggaagccgtactttaaaagatgcagttgatgaggccttaaaa
gatctgattgaaaactatgataatactttttatatgctcgggtcagcggtaggtcctgat
ccctatcctacaatagttagacattttcagtctgttatcggcaaggaagctaaaaaacag
ataattgaaaaagaaggtcgtctgcctgactatataattgcctgtgtcggtggtggaagt
aatgctattggtctgttttatccctttattgaagataaggaggttaatataattggagta
gaaccgggaggaaagggctcagaaccggggcaaaatgcagctcccttaaattttggtgag
cccggtgtcttacatggttttatgtgctatatgcttaaagataaaaaaggaaatgttgct
tctacccattcaatagcagcaggacttgattatcctggtgtaggaccggaacatagctat
ttaaaagaaacaggtcgggcccggtatacaaccataaatgatgaagaagcccttaaggct
tttaatcttctgtcacaggttgaaggtattattccggccctggaaagttcccacgccgtt
gcccaggctataaagctggctccagaattagataaaaaccagattattattgttaatctt
tcaggccggggagataaagatgtccatcagattgctggtttaatggacaaaatttaa

DBGET integrated database retrieval system