KEGG   Halothermothrix orenii: Hore_17370Help
Entry
Hore_17370        CDS       T00838                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hor  Halothermothrix orenii
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:hor00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Hore_17370
   00052 Galactose metabolism
    Hore_17370
   00500 Starch and sucrose metabolism
    Hore_17370
   00520 Amino sugar and nucleotide sugar metabolism
    Hore_17370
Enzymes [BR:hor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Hore_17370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1855199..1856113)
Genome map
AA seq 304 aa AA seqDB search
MKVKKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEEAIEAGIEDILIITGKHK
RAIEDHFDKSIELELALEKKGKDDLLKMVKDISNMVDIHYVRQKEPKGLGHAIYCARTFI
GDEPFAVLLGDDVIYSKRSVIGQMIDVFEKREEPVIGVQQVPEKEVSKYGIVKYDRQEED
IYHIEDLIEKPDIDKAPSNLAILGRYVITPDIFPILARTKPGRNNEIQLTDALRELASER
NMVAYNFSGKRYDVGNKMGFLQATVEYALRREDLGDEFFKYLVNLMEQEAEKRGHSTIVN
SRTG
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtaaaaaaagcaataataccggcagcaggccttggaaccagatttttaccggct
acaaaagcccagcctaaagaaatgttgccgatagttgataaaccgactatccagtacatt
atagaagaagcaatcgaggccgggattgaagatatcttaataattaccggtaaacataaa
cgggctattgaagaccattttgataaatcaatagaactggagctggctttagaaaaaaaa
gggaaagatgacctgttaaaaatggttaaggatatatcaaatatggtcgatattcattat
gtaaggcagaaagaacctaaagggcttggtcatgctatttactgtgcccggacatttatc
ggggatgaaccctttgcagtcctgctgggggatgatgtcatatattctaaacgaagtgtt
atcgggcaaatgatagatgtctttgaaaagagggaagaaccggttataggtgtccagcag
gttcctgaaaaggaggtcagtaagtacggtattgtcaaatatgaccgacaggaagaggat
atataccatattgaggacttaatagagaaaccggatatagataaggccccctctaatctg
gctattctgggtcgttatgttattactcccgatattttcccgatcctggcccggacaaag
cccggccgaaataatgaaattcagttaacagatgctttacgggaacttgcttcagagagg
aatatggttgcctataacttttcaggcaaaaggtatgatgtgggtaataaaatgggtttt
ctccaggcaacagtagaatatgctttaaggagggaagacctcggggatgaattttttaaa
tatctggttaatttaatggaacaggaagcagaaaaaaggggccactctacaattgttaac
tccagaacaggttaa

DBGET integrated database retrieval system