KEGG   Halothermothrix orenii: Hore_18470Help
Entry
Hore_18470        CDS       T00838                                 

Definition
(GenBank) L-fuculose phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hor  Halothermothrix orenii
Pathway
hor00051  Fructose and mannose metabolism
hor01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hor00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Hore_18470
Enzymes [BR:hor01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Hore_18470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II Gp5_OB
Motif
Other DBs
NCBI-ProteinID: ACL70596
JGI: Hore1847
UniProt: B8CZ77
Position
complement(1971885..1972529)
Genome map
AA seq 214 aa AA seqDB search
MASYEKIVVSAGLEMCQRSLTVGTWGNISCRNPETGEIYLTPSGIDYKKIKQEDIVVFNR
DGKVIRGDKKPSIENQLHLKIYEAREDVNAIIHTHAVYSGAFAITGEKIPPVSEDFVQIV
GDSVRCADYALPGTKELALNAVKALGDRKAVLLLNHGTVCVGEDMDEAFKVCDVVEKTAR
LYIYSRFIGEPRLIPDDDIKAMQEFVKNSYGQDK
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atggccagttatgagaaaattgttgtttccgcaggtcttgagatgtgccagcggagtctg
acagtgggtacctggggtaatataagctgccggaacccggaaaccggggaaatttaccta
actcccagtggtattgactataaaaaaattaagcaggaggatattgtggttttcaataga
gatggtaaagtaatcaggggtgataaaaaaccatcgattgaaaatcaattacaccttaag
atatatgaggcccgtgaagatgttaatgctatcatccatacccatgctgtttactccggg
gcttttgccatcaccggtgaaaaaattccaccagtatcggaggactttgtccagattgtt
ggggattcggtaaggtgtgctgattatgccctgccgggtactaaggaacttgcattaaat
gctgtaaaagccctcggagatagaaaagcggtgttattactaaatcatggaacggtatgt
gtcggtgaggatatggacgaggcctttaaggtatgtgatgtggtggagaaaacagccagg
ctttatatatacagcaggtttattggtgaaccgagattgatacctgatgatgatatcaaa
gctatgcaggagtttgtaaaaaatagttatggccaggataagtaa

DBGET integrated database retrieval system