KEGG   Halothermothrix orenii: Hore_19530Help
Entry
Hore_19530        CDS       T00838                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
hor  Halothermothrix orenii
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hor00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Hore_19530
   00051 Fructose and mannose metabolism
    Hore_19530
Enzymes [BR:hor01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Hore_19530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2094086..2095405)
Genome map
AA seq 439 aa AA seqDB search
MEVFKNVPQTIKYEGKDSDNPLAFKYYNPEEKVGGKTMEEHLRFSVAYWHTLTGDGSDPF
GMGTMLRPWDTATDPMELAKARVRAAFEFMSKLGVKYFCFHDRDIAPEGRTLAETNKNLD
EIVSLIKELMDETGIKLLWGTANLFSNPRFVHGAATSPNADVFAYAAAQVKKAMEITKEL
GGENYVFWGGREGYETLLNTDMELEQENFARFLHMAVDYAREIGFEGQFLIEPKPKEPTK
HQYDFDAATVISFLKKYDLDKHFKLNIEANHATLAGHTFQHELHVSRINGMLGSVDANQG
DLLLGWDTDQFPTNIYETTLAMYEILKNGGLEPGGLNFDAKVRRASFEPVDLFYAHIAGM
DAFARGLKVAHKLLESGELEDFISERYKSYRNGIGEKIVKGEVGFKELEDYALNNGKITN
VSGRQELLESIVNKYIIEA
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggaagtatttaaaaatgtaccacaaacaataaaatatgaaggaaaagattctgataac
cctcttgcctttaagtactacaatcctgaagaaaaagttggcggcaaaacaatggaggaa
catttgaggttttcagtggcttactggcacaccctgaccggggatggatccgaccccttc
ggaatgggaaccatgttaagaccatgggatactgcaactgatcctatggagcttgctaaa
gccagggtcagggctgcctttgaatttatgagcaaactgggtgtcaaatacttctgtttc
catgacagggatattgctccggaaggaagaacactggctgagaccaataaaaaccttgat
gaaattgtttctttaataaaagaattaatggatgaaaccggtattaagcttctctggggt
acagccaatctattctcaaaccccaggtttgttcatggagcggctacttcccccaacgct
gatgtttttgcctatgccgctgcccaggttaaaaaagccatggagattaccaaagaactc
ggtggtgaaaactatgtcttctggggtggtcgtgagggttatgaaaccctgttaaatacc
gatatggaactcgagcaggaaaacttcgcccggttcctgcacatggctgttgactatgcc
agagagattggatttgaagggcagtttttaatcgaacccaaaccaaaagagccaaccaag
caccagtatgactttgatgctgcaactgttattagttttttgaaaaagtatgaccttgat
aaacattttaaactaaacatagaagcaaaccatgctactctggctggccatactttccag
catgaactccatgtttcaagaataaatggaatgctgggtagtgtagatgccaaccagggt
gacctgttactgggctgggataccgaccagttcccgaccaatatttatgaaaccaccctt
gccatgtatgaaatactgaaaaatggtggtcttgaacccggagggttaaactttgatgct
aaagtaaggagggcgtctttcgaacctgttgatctcttctatgctcacattgccggaatg
gatgcctttgcccgtggtttaaaggttgcccataaactccttgaaagtggagaactggaa
gactttatctcagaacgttataagagttatcgtaatggtattggagagaagattgttaag
ggtgaagttggttttaaagaacttgaagattatgccctgaataatggtaagattaccaat
gtttctggacgccaggaattgctggaatctattgttaacaaatatatcatcgaagcttag

DBGET integrated database retrieval system