KEGG   Halothermothrix orenii: Hore_20490Help
Entry
Hore_20490        CDS       T00838                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
hor  Halothermothrix orenii
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hor00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Hore_20490
  Lipid metabolism
   00600 Sphingolipid metabolism
    Hore_20490
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Hore_20490
Enzymes [BR:hor01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Hore_20490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2211551..2213803)
Genome map
AA seq 750 aa AA seqDB search
MKRKILNFNTDWFFLDKDIEGAKGIDFSQSGMEKVNLPHPNRILPHHYFEESDYQFVSWY
RRPFYLEEEYKGKRVIVEFDGVMTVAEIYVNGQFVGEHKGGYTSFSFDITDYLLSGENNL
LAVRVDSSQRKDIPPEGNLVDYLLFGGIYRDVKMVIVDPVYINWSFIELKDVNLEAGVIK
PRFELVNTTGNRQKIVLNSQVINKEGKVVAMVESRHLLEPGVTSLEQPEVKIKEPELWHP
DHPYLYHVYTEVKVEGKLVDDYKTRIGLRKVEFKEDGKFYINDKPLKLRGLNRHQMFPYL
GNAMPDRGQRKDAEILKYELGLNFVRSSHYPADSSFLDKCDEIGLLVLEEIPGWQHIGNR
DWQELSKRNVEEMIVRDRNHPCIFLWGVRINESPDNHDFYLETNEIAHRLDSTRPTCGIR
NFQDSEFLEDVFTYNDFELNLEGKIKLPNHQPYMITEYMGHMYPTKAYDSVERLIKHAVR
HAHIQDKQYGVPYLAGASGWCAFDYNTHADFGSGDRVCYHGVCDMFRLPKFAAYFYKSQI
DPDVEKVVFIARYLTPSFNEDYGDEVIVFSNCEEVELYVGDKLITSARPNRVDYPSLPHP
PFTFKDCTWWEWGASTISCLKAVGKIDGKQVAEHTIYPFGRPERLVLKPDYTKLTADGAD
CTRVVVELQDEHGQVLHLAHHPVFFELEGVGELIGENPFSLEVGRGAVFIRAGRTPGKIQ
LTGKVQGLPPVTIVVSTEPLEDKIVPLPRK
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggaaaatattaaactttaatacggactggttttttcttgataaggatatagaa
ggagcaaaaggaatagattttagtcaatcagggatggagaaagtaaatctacctcatccc
aacaggattttaccacaccattattttgaagaatctgattatcagtttgtttcctggtac
aggcgccctttttacctggaagaagagtataaagggaaaagggtgatagtagagtttgat
ggagtaatgacggttgctgaaatatatgttaatgggcagtttgtgggtgagcataaaggg
ggctatacttcttttagttttgatataacagattatctgctatctggagaaaataatctg
ctggcagtcagggtggattccagccagagaaaggatattcccccggaaggcaacctggtc
gattaccttttgtttggaggtatataccgggatgttaaaatggtgatagtagaccctgtt
tatattaactggtcttttattgaacttaaagatgtaaacctggaagcaggtgttataaaa
cccaggtttgagctcgtaaacacaacaggtaaccggcaaaaaatagtcttaaatagtcag
gttattaataaagaaggtaaggttgtggcaatggtagaatccagacacctgcttgagccc
ggtgtaacctctctggagcagcctgaggtcaagataaaagaacctgagttatggcatcct
gaccatccctatctctatcatgtttatactgaagttaaagttgaaggaaagctggttgat
gattataaaaccagaatcggactcaggaaagtggaatttaaagaggatggaaagttttat
atcaacgataagccccttaaactcaggggacttaacaggcatcaaatgtttccgtatcta
ggtaatgctatgcctgaccggggccagaggaaggatgctgagattttgaagtatgaactg
gggttaaattttgtccgttcttcccattacccggctgattcttcgtttttagataagtgt
gatgaaataggtttattagtcctggaagagatccccggatggcagcatatcgggaacagg
gactggcaggagttatctaaaagaaatgttgaagagatgatagtcagagaccggaaccat
ccctgtattttcctctggggtgttagaattaatgaatctccggataaccatgatttttac
cttgagacaaatgaaattgcccacagactggacagtaccaggccgacctgtgggataagg
aattttcaggatagtgagtttctggaagatgtatttacttataatgattttgagttaaat
ctcgaaggaaaaattaaattacctaaccaccaaccatatatgataaccgaatatatgggt
catatgtatccaaccaaggcctatgatagtgtcgaaaggttaattaaacacgctgtccgg
cacgcccatatacaggataagcagtatggggtaccttatctggcaggggcctcagggtgg
tgtgcctttgattataatacccatgctgattttggatcaggtgacagggtatgctatcac
ggagtctgtgatatgttcaggttacccaaatttgctgcttatttttataaaagccagata
gacccggatgtggaaaaggttgtatttattgctcgatacctgaccccatcttttaatgag
gattatggcgatgaggttattgtttttagtaactgtgaagaggttgaactatatgttggt
gataaattaataacatcagctagaccaaaccgggttgattaccccagtttaccccacccg
ccctttacctttaaagactgtacctggtgggagtggggggccagcaccatttcctgcctg
aaagcggtcggtaaaatagatgggaaacaggttgccgagcacactatttatccctttggc
aggccggagaggttagtattaaagccggattacactaaacttacggcagatggtgctgat
tgtacccgggttgtggttgagcttcaggatgagcacggacaggtcctccatctggcccat
catccggttttctttgaactggaaggggtgggggaactaattggagaaaacccctttagc
ctggaagtagggagaggtgctgtctttataagggccgggagaactccagggaaaatacag
ctgacaggtaaggtccagggattaccaccggtcacaatagttgtatctactgaacctctg
gaagataagatagtaccattacccaggaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system