KEGG   Halothermothrix orenii: Hore_20740Help
Entry
Hore_20740        CDS       T00838                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
hor  Halothermothrix orenii
Pathway
hor00010  Glycolysis / Gluconeogenesis
hor00020  Citrate cycle (TCA cycle)
hor00620  Pyruvate metabolism
hor00633  Nitrotoluene degradation
hor00640  Propanoate metabolism
hor00650  Butanoate metabolism
hor00680  Methane metabolism
hor01100  Metabolic pathways
hor01120  Microbial metabolism in diverse environments
hor01130  Biosynthesis of antibiotics
hor01200  Carbon metabolism
Module
hor_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hor00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hore_20740
   00020 Citrate cycle (TCA cycle)
    Hore_20740
   00620 Pyruvate metabolism
    Hore_20740
   00640 Propanoate metabolism
    Hore_20740
   00650 Butanoate metabolism
    Hore_20740
  Energy metabolism
   00680 Methane metabolism
    Hore_20740
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Hore_20740
Enzymes [BR:hor01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Hore_20740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR
Motif
Other DBs
NCBI-ProteinID: ACL70819
JGI: Hore2074
UniProt: B8CZW7
Position
complement(2243782..2244360)
Genome map
AA seq 192 aa AA seqDB search
MLEIRWHGRGGQGSKTASILLAKIASATGKHIQAFPEYGPERMGAPVLAYTRISDGPIHL
HCQVETPDLVVVLDPTLIGTVDITQNLKKGGNLIINSDYEPDKIRDKLGLAADVNTYTID
ANTISEEEIGRIFPNTPMLGAINRVVNLMDQDSFLNQAREELKKKFSHKPEVIEGNMRSI
DMAYREVKGLNG
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgctggaaataagatggcacggaaggggtggtcaggggtcaaagaccgcctctatttta
ttagctaaaatagcatcggctaccggtaaacatattcaggcttttccggagtatggtccg
gaaaggatgggagccccggttcttgcttatactagaataagtgatggtcccattcatctc
cattgtcaggttgaaacccctgacctggttgtggtcctggacccgaccctgattggaacg
gtggatattacccagaatttaaaaaaagggggtaatcttattataaattctgattatgag
cccgataaaatcagggataaactcggcctggctgcggatgttaatacttatacaattgat
gccaatacaatttctgaggaagagatcggacgaatttttcccaacacacctatgctgggg
gcaataaacagggtagttaatttaatggaccaggattcatttctcaatcaggcccgtgaa
gaattgaaaaaaaagttttcccacaaaccagaggtaattgagggaaatatgcgctctata
gacatggcttaccgggaggtgaaagggcttaatggctaa

DBGET integrated database retrieval system