KEGG   Halothermothrix orenii: Hore_20770Help
Entry
Hore_20770        CDS       T00838                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
hor  Halothermothrix orenii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hor00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Hore_20770
DNA repair and recombination proteins [BR:hor03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Hore_20770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2245414..2246010)
Genome map
AA seq 198 aa AA seqDB search
MRYYPQPMGKLINQLSRLPGIGPKTAQRLAFYILRLNPSEVRELSQSMIDAREKTKYCSV
CNNLTEKDPCDFCSSPERDHNLICVVESPKDVIAMERTGEYKGLYHVLHGSISPIDGIGP
EDIKIRNLLPRLKEGVKEVIVATDPNAEGDATAMYLARLIKPLGVKVTRIAHGLPVGGDL
EYADEVTLSKALEGRREM
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcgttattatccccagcctatggggaaattaattaatcaattgagcaggctgccagga
attggaccaaaaactgcccagcgcctggctttttatatcctgagattaaacccttcagag
gtaagggagctctcccagtccatgattgatgccagggagaaaacaaagtattgttctgtc
tgtaataatttaaccgaaaaggacccctgtgacttctgttcctcacccgaaagggaccat
aatttaatatgtgtggttgaaagtcctaaagacgttattgccatggaaagaacaggggaa
tacaaaggtttatatcatgtgttacatggatctatttctcccatagatggaattggacca
gaggatataaaaattagaaacctccttccccgcttgaaagagggggtaaaagaggttata
gtggctactgatcccaatgctgagggtgatgctactgctatgtatctggccaggttaata
aaacctctgggggtaaaagtcaccaggattgcccacgggctcccggtaggtggtgacctg
gaatatgctgatgaggttaccctgtctaaagcattagaagggagacgagaaatgtga

DBGET integrated database retrieval system