KEGG   Halothermothrix orenii: Hore_23300Help
Entry
Hore_23300        CDS       T00838                                 

Definition
glycoside hydrolase family protein (EC:3.2.1.22)
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
hor  Halothermothrix orenii
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:hor00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Hore_23300
  Lipid metabolism
   00561 Glycerolipid metabolism
    Hore_23300
   00600 Sphingolipid metabolism
    Hore_23300
Enzymes [BR:hor01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Hore_23300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2549402..2550700
Genome map
AA seq 432 aa AA seqDB search
MPKITFLGAGSTVFAKNVLGDCMLTPALRDSHIALYDIDHQRLRESEQMLKSINRNSNQN
RAEIVAYTDRKEALRDSDYVVNAIQVGGYKPCTVTDFEVPKKYGLRQTIGDTLGIGGIFR
ALRTIPILLDFARDIEEVCPDAWFLNYTNPMAILTGAMLKATNVKTVGLCHSVQTCVPDL
LKDLGMSTENVQWKIAGINHMAWLLEITRNGRDLYPEIKEKARARKKPHDDMVRYEIMER
FGYYVTESSEHNAEYMPYFIKSNYPELIEKYNIPLDEYPRRCEQQIKDWEEMKDKLVHND
NLEHSRTHEYASYIMEAMETDKPYKIGGNVLNTGLITNLPEDACVEVPCLVDRSGVTPCY
VGDLPPQLAALNRTNINVQLLTIEAALTRKKEYIYQAAMLDPHTAAELSIDEIYALVDDM
IEAHGDWLPEYK
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaaataacatttctcggggctggaagtactgtatttgctaaaaatgttctgggg
gattgtatgttaaccccggccttaagagattcccatatcgccctgtatgacattgatcac
cagcgcttacgggaatctgaacaaatgcttaaaagtattaatagaaactcaaaccaaaac
agggcagaaattgttgcttatacagaccgtaaagaagccctccgggattctgactacgtt
gttaacgctatccaggtaggtggatacaaaccctgtactgttaccgattttgaggtcccg
aaaaaatacggtttacgacagaccatcggggataccctgggtatcggtggtattttcagg
gccttaagaactataccgatcctcctggattttgccagggatattgaagaagtatgtcct
gacgcctggtttttaaattataccaatcccatggccattttaaccggggctatgctcaaa
gcaaccaatgttaagacagttggcctctgccacagtgtccagacctgtgttcctgatcta
cttaaagacctgggaatgagtactgaaaacgtccagtggaagatagccggtattaaccac
atggcctggcttttggaaataaccagaaacggccgggacctttatcctgaaattaaagaa
aaggcccgggcccgaaaaaaaccccatgatgacatggtcaggtatgaaataatggaacgc
tttggctactatgtcaccgaatccagtgaacacaatgctgaatatatgccctatttcatc
aaaagcaactaccctgaattaatcgaaaaatataatattcctctcgatgagtatcctcgc
cgttgtgaacaacaaataaaagactgggaagagatgaaagacaaactggtccacaatgat
aatcttgaacacagtcggacccatgaatatgcttcctatattatggaagccatggaaaca
gataagccctataaaattggggggaacgtcctgaatacagggcttattaccaacctccct
gaagatgcctgtgtagaggttccctgcctggtggacaggagtggggttaccccctgttat
gtgggagacctgccacctcaactggctgccctgaaccggacaaatatcaatgttcagttg
ctgaccattgaagctgccctgacccggaaaaaagaatacatttaccaggcagccatgctg
gatcctcatacagctgccgaattatctattgatgagatttatgccctggttgatgatatg
attgaagcccatggtgactggctccctgaatataaataa

DBGET integrated database retrieval system