KEGG   Helicobacter pylori HPAG1: HPAG1_0160Help
Entry
HPAG1_0160        CDS       T00365                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
hpa  Helicobacter pylori HPAG1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hpa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HPAG1_0160
Enzymes [BR:hpa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     HPAG1_0160
Exosome [BR:hpa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HPAG1_0160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(166719..167690)
Genome map
AA seq 323 aa AA seqDB search
MFKRLRRLRSSENLRAMLRETRLNIDDFIAPLFVIESGSYIKNEINSMPGVYQMSIEPLL
KECEELVGLGVKAVLLFGIPKHKDATGSHALNKDHIVAKAARAIKKRFKDLIVIADLCFC
EYTDHGHCGILENDSVSNDKTLEILNLQGLILAESGVDILAPSNMMDGNVLSLRKALDKA
GYFHTPIMSYSTKFASSYYGPFRDVANSAPSFGDRKSYQMDYANQKEALLESLEDEKQGA
DILMVKPALAYLDIVKEIRDHTLLPLALYNVSGEYAMLKLAQKHNLINYESVLLETMTCF
KRAGADMIISYHAKEIANLLQRN
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaacgattgagaagattacgaagcagcgaaaatttaagagcgatgttaagagaa
acgcgcctaaatattgatgatttcatcgctcccttatttgtcatagaaagcggtagttat
attaaaaatgaaattaactccatgcctggcgtgtatcaaatgagtatagaacctctttta
aaagaatgcgaagaattagtgggtttaggcgtcaaagccgttttattgtttggcattcct
aaacataaggacgctacaggaagccatgcactaaataaggatcacattgtcgcaaaagcc
gctagagcgattaaaaaacgattcaaggatttaatcgttatagcggatttgtgtttttgt
gaatacaccgaccatgggcattgcgggattttagaaaacgattctgtgtctaacgacaaa
acgctagagattttaaatcttcaagggcttattttggctgaaagcggtgtggatattcta
gccccaagcaacatgatggatggcaatgttttgagcttgagaaaagcgctagataaggcc
gggtattttcacacgcccatcatgagctattccactaaatttgcgagcagttattacggg
ccttttagagatgtagccaattctgcgccgagttttggcgatcgcaaaagctatcaaatg
gattacgctaaccaaaaagaagcgcttttagaaagtttagaagatgaaaagcagggtgcg
gatattttaatggtgaaaccggctttggcgtatctagatattgttaaagaaatcagagat
cacactttgctccctttagcgctctataatgtgagcggggaatacgccatgctcaaactc
gctcaaaaacacaacctgatcaactatgaaagcgttttattagaaacgatgacttgtttt
aaaagagcgggagcggatatgattattagctatcatgctaaagaaatagctaacttatta
caaaggaattga

DBGET integrated database retrieval system