KEGG   Helicobacter pylori HPAG1: HPAG1_0213Help
Entry
HPAG1_0213        CDS       T00365                                 

Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
hpa  Helicobacter pylori HPAG1
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hpa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPAG1_0213
  Amino acid metabolism
   00300 Lysine biosynthesis
    HPAG1_0213
Enzymes [BR:hpa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     HPAG1_0213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(216501..217652)
Genome map
AA seq 383 aa AA seqDB search
MDALEITQKLISYPTITPKECGIFEYIKSLFPHFKTLECGENGVKNLFLYRIFNPPKDHA
EEKHAKENVKPLHFSFAGHIDVVPPGDHWQNDPFKPVIKEGFLYGRGAQDMKGGVGAFLS
ASLNFNPKTPFLLSILLTSDEEGPGIFGTKLMLEKLKEKDLLPHMAIVAEPTCEKVLGDS
IKIGRRGSINGKLILKGIQGHAAYPKKCQNPIDTLASVLPLISGVNLDDGDEYFDPSKLV
ITNLHAGLGANNVTPASVEIIFNARHSLKTTKESLKEYLEKVLKDLPHTLELESSSSPFI
TASHSKLTSVLKENILKTCRTTPLLNTKGGTSDARFFSAHGIEVVEFGVINDRIHAIDER
VSLKELELLEKVFLGVLEDLSEK
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggacgctttagaaatcacccaaaagctcatcagctaccccaccattacgcccaaagaa
tgcggtatttttgaatacattaaatcgctttttcctcattttaaaactctagagtgtgga
gaaaatggcgtgaaaaacctttttttataccgcatttttaacccccccaaagaccatgca
gaagaaaagcatgcaaaagaaaatgttaagcccttgcatttttcttttgcagggcatatt
gatgtcgtgcctcctggagatcattggcaaaacgatccttttaaacccgttattaaagag
gggtttttatacggccgtggggcgcaagacatgaaaggaggcgtgggggcgtttttgagc
gcgagtttaaattttaaccctaaaaccccttttttgctttctattttactcacaagcgat
gaagaagggccagggatttttggcacaaaactcatgttagaaaagctcaaagaaaaagat
ttgttgcctcatatggcgattgtggctgaacccacttgcgaaaaagtcctaggcgatagc
atcaaaattggccgaagaggctctattaatggcaaactcattttaaaaggcattcaaggg
catgcggcttacccaaaaaaatgccaaaaccccattgatacgctcgcttctgttttgccc
ttgatttcaggagttaatttagacgatggcgatgaatattttgacccttcaaaattggtt
atcaccaacttgcatgcagggttaggagcgaataacgttaccccggcaagcgtagaaatc
atctttaatgcacgccattctttaaaaaccaccaaagagagtttgaaagaatatttagaa
aaagttttaaaagatttgcctcacactttagaattagagtcaagcagttcgcctttcatc
acggcttctcattcaaagcttaccagcgttttaaaagaaaatattttaaagacatgccgc
accaccccccttttaaacaccaaaggcggcacgagcgatgcgcgattttttagcgctcat
ggtatagaagtggtggaatttggcgttattaatgacaggattcatgccattgatgaaagg
gtgagcttgaaagaattagagcttttagaaaaagtgtttttgggggttttagaggatttg
agcgagaaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system