KEGG   Helicobacter pylori HPAG1: HPAG1_0278Help
Entry
HPAG1_0278        CDS       T00365                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hpa  Helicobacter pylori HPAG1
Pathway
hpa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hpa01100  Metabolic pathways
hpa01110  Biosynthesis of secondary metabolites
hpa01130  Biosynthesis of antibiotics
hpa01230  Biosynthesis of amino acids
Module
hpa_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpa00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPAG1_0278
Enzymes [BR:hpa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HPAG1_0278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: ABF84345
UniProt: Q1CUM7
Position
281919..282464
Genome map
AA seq 181 aa AA seqDB search
MQEIGILENLQKSLALKEGMLSYEMLGKSLSYNPYLPRVIPQTKDCVFVTPDEVLEKLLK
ENTHTDCVIVNFKGLYEIGAPSVFDLEVLGLLRRHASSLIVHQDLFISHYQLLESLVQGS
DGVILDEELLKEDLKGMVEFAWRLGLGVFVETHKQDYTHLKDLGVLGVLEKVPHSQNQKK
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaatagggattttagaaaatttacaaaaaagcttagccttaaaagagggcatg
ctttcttatgaaatgttaggtaaaagcctgtcgtataacccttacttgcctagagtcatt
cctcaaactaaagattgtgtttttgtaacccctgatgaggttttagaaaagcttttgaaa
gaaaacacccacaccgattgcgttattgtcaatttcaaaggattatacgaaataggcgcg
ccaagcgtgtttgatttagaagttttagggttattgcgtcgccatgcgagttctttgatt
gtccatcaagatcttttcatcagccattaccagcttttagaatcgcttgttcaaggctct
gatggggtcattttagacgaagagcttttgaaagaagatttaaagggcatggtagaattt
gcttggcgtttgggcttaggcgtgtttgtagaaacccacaaacaagactacacccattta
aaagatttaggggttttaggcgtgctagaaaaagtcccccattctcaaaatcaaaaaaaa
aaatag

DBGET integrated database retrieval system