KEGG   Helicobacter pylori HPAG1: HPAG1_0278Help
Entry
HPAG1_0278        CDS       T00365                                 

Definition
hypothetical protein
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hpa  Helicobacter pylori HPAG1
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPAG1_0278
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPAG1_0278
Enzymes [BR:hpa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HPAG1_0278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
281919..282464
Genome map
AA seq 181 aa AA seqDB search
MQEIGILENLQKSLALKEGMLSYEMLGKSLSYNPYLPRVIPQTKDCVFVTPDEVLEKLLK
ENTHTDCVIVNFKGLYEIGAPSVFDLEVLGLLRRHASSLIVHQDLFISHYQLLESLVQGS
DGVILDEELLKEDLKGMVEFAWRLGLGVFVETHKQDYTHLKDLGVLGVLEKVPHSQNQKK
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaatagggattttagaaaatttacaaaaaagcttagccttaaaagagggcatg
ctttcttatgaaatgttaggtaaaagcctgtcgtataacccttacttgcctagagtcatt
cctcaaactaaagattgtgtttttgtaacccctgatgaggttttagaaaagcttttgaaa
gaaaacacccacaccgattgcgttattgtcaatttcaaaggattatacgaaataggcgcg
ccaagcgtgtttgatttagaagttttagggttattgcgtcgccatgcgagttctttgatt
gtccatcaagatcttttcatcagccattaccagcttttagaatcgcttgttcaaggctct
gatggggtcattttagacgaagagcttttgaaagaagatttaaagggcatggtagaattt
gcttggcgtttgggcttaggcgtgtttgtagaaacccacaaacaagactacacccattta
aaagatttaggggttttaggcgtgctagaaaaagtcccccattctcaaaatcaaaaaaaa
aaatag

DBGET integrated database retrieval system