KEGG   Helicobacter pylori HPAG1: HPAG1_0402Help
Entry
HPAG1_0402        CDS       T00365                                 

Definition
acetyl-CoA synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hpa  Helicobacter pylori HPAG1
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hpa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HPAG1_0402
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPAG1_0402
   00620 Pyruvate metabolism
    HPAG1_0402
   00640 Propanoate metabolism
    HPAG1_0402
  Energy metabolism
   00680 Methane metabolism
    HPAG1_0402
Enzymes [BR:hpa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     HPAG1_0402
Lipid biosynthesis proteins [BR:hpa01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   HPAG1_0402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(410346..412334)
Genome map
AA seq 662 aa AA seqDB search
MQLDDDLEFAKKIFNPNRAFAKQARIKNMCEYKDLVHEANEDYEHFWGELAKQKLTWFKP
FDKVLNSDNAPFFKWFENGKINVSYNCIDRHLKDKKNKVAIIFEGEMGDYNVITYRKLHS
EVNKTANLLKNEFNVKKGDRVIIYMPMIVESVYMMLACARIGAIHSIVFAGFSPEALRDR
INDAQAKLVITADGTFRKGKPYMLKPALDKALENNACPSVEKALIVIRNAKEIDYVRGRD
FVYNEMVNYQSDKCEPEMMDSEDPLFLLYTSGSTGKPKGVQHSNAGYLLWAQMTMEWVFD
IRDNDNFWCTADIGWITGHTYVVYGPLACGATTLILEGTMSYPDYGRWWRMIEEYRVDKF
YTSPTAIRMLHAKGENEPLKYNLESLKVLGTVGEPINPTAWKWFYEKIGNSKCSIVDTWW
QTETGGHIISPLPGATPIRASCATLPLPGIHAEVLNEDGTKTKPGEQGFLCITKPWPSMV
RNIWGDEKRYIDSYFSQIKLNGEYVYLSGDGAIVDENGYITIIGRTDDIVNVSGHRIGTA
EVESAISKHEMVVECAVVGIPDTIKGEGLFAFVVLCDGAKCNLGESLELLKEMNHILSVE
IGKIAKLDNVMYVPGLPKTRSGKIMRRLLKSIAKKEPITQDLSTLEDVNVVKEIMSIVQM
EE
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgcaattagacgatgatttggaattcgctaaaaaaatctttaaccctaacagagcgttt
gccaagcaagccaggattaaaaacatgtgcgaatataaagatttagtgcatgaagccaat
gaagattatgaacatttttggggcgagttagccaagcaaaaactcacatggtttaaacct
tttgataaggttttaaacagcgataacgccccttttttcaaatggtttgaaaacggcaag
atcaatgtttcttacaattgcatagacaggcatttaaaagacaaaaaaaataaagtggcg
atcatttttgaaggggaaatgggggattataatgtcatcacttacagaaaactccactct
gaagtcaataaaacagccaaccttttaaaaaacgaattcaatgtcaaaaaaggcgataga
gtcattatctatatgcctatgattgtagaaagcgtttatatgatgctcgcatgcgctagg
attggagcgatccatagcatcgtttttgctgggtttagccctgaagccttaagggatagg
atcaacgacgctcaagctaaattagttatcacagcggacgggacttttagaaaaggcaaa
ccttatatgctcaagccagcccttgacaaggctctagaaaataacgcctgccctagcgtg
gaaaaagcgctcattgtgatacgaaacgccaaagagattgactatgtgagagggcgcgat
tttgtctataatgaaatggtcaattaccaatccgataaatgcgagcctgaaatgatggac
tctgaagatcctttattcttgctctatacaagcggatcaaccggaaagcctaaaggcgtt
caacacagcaatgcagggtatttgctatgggcgcaaatgacgatggagtgggtttttgat
attagagataacgataatttttggtgcaccgctgatattggctggatcacagggcacact
tatgtggtttatgggcccttagcttgtggggcgacaactttgatactagaaggcacgatg
tcttatccggattatggaagatggtggagaatgatagaagaataccgcgtggataaattc
tacacttcccccactgctataagaatgctgcatgccaaaggcgaaaacgaacccttaaag
tataatttagagtcactcaaagttttaggaacggtaggagagcccattaaccctacggca
tggaaatggttttatgaaaaaatcggcaactcaaaatgcagtatcgtggatacttggtgg
cagacagaaacaggtgggcatatcatcagccctttaccgggagctacgcctataagggcc
agctgtgcaactttgcctttgcctggaatccatgcagaagttttaaacgaagacggcacc
aaaacaaagcccggagagcaagggtttttatgcatcactaagccatggccttctatggta
agaaacatttggggcgatgaaaaacgatacattgatagctatttttctcagatcaagttg
aatggggaatatgtctacctctctggagatggcgctatcgtggatgaaaacggatacatc
actattattgggcgcacagatgatattgtgaatgtgagtgggcataggattggcacggct
gaagtggagagcgctatttctaaacatgaaatggtggttgaatgcgcggtagtgggtatc
cctgatacgattaaaggagagggcttgtttgcgtttgtggtgctgtgtgatggggctaaa
tgcaatcttggcgagagtttagaattattaaaagaaatgaatcatatcttatccgttgaa
attggaaagatcgctaaattagacaatgtcatgtatgtgccgggtttacctaaaaccaga
agcgggaaaatcatgagaaggcttttaaaatccatcgccaaaaaagagcccatcactcaa
gatttaagcacgctagaagatgtgaatgtggttaaagaaataatgagtatcgttcaaatg
gaagagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system