KEGG   Helicobacter pylori HPAG1: HPAG1_0411Help
Entry
HPAG1_0411        CDS       T00365                                 

Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
hpa  Helicobacter pylori HPAG1
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hpa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HPAG1_0411
Enzymes [BR:hpa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     HPAG1_0411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
421895..422386
Genome map
AA seq 163 aa AA seqDB search
MMREILTNRFFPSLFKKRLDFSNRVVLGLGSNLKNPLKILKNCFLYFKNHSKIGKIFSSP
IYINPPFGYTNQPNFYNATIILKTSLSLRHFFALVFYIERRFGRARKRDFKDAPRTLDID
IIAFNQVILRQNDLTLPHPKWSERDSVLMPLALQQILFKKGEW
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
gtgatgcgagagatccttactaaccgctttttccccagcctttttaaaaaaaggcttgat
ttttctaacagggtggttttagggttgggatctaatcttaaaaatcctttaaaaatatta
aaaaattgttttttgtattttaaaaatcatagtaaaattgggaaaattttttcttcgccc
atttatatcaatcctccttttggttacactaatcaacctaacttttataacgctacgatt
atccttaaaacatctttaagtttacgccatttttttgctctggttttttatatagaaagg
cgttttggccgtgcaaggaagcgcgattttaaagacgctccaagaactttagatattgat
attatcgctttcaaccaagtcattttaaggcagaacgatttgactttacctcaccctaaa
tggagtgaaagggattcggtgttaatgccgttggctttgcaacaaattctttttaaaaaa
ggggagtggtga

DBGET integrated database retrieval system