KEGG   Helicobacter pylori HPAG1: HPAG1_0475Help
Entry
HPAG1_0475        CDS       T00365                                 

Definition
phospholipase A1 (EC:3.1.1.32)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
hpa  Helicobacter pylori HPAG1
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hpa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    HPAG1_0475
   00565 Ether lipid metabolism
    HPAG1_0475
   00590 Arachidonic acid metabolism
    HPAG1_0475
   00591 Linoleic acid metabolism
    HPAG1_0475
   00592 alpha-Linolenic acid metabolism
    HPAG1_0475
Enzymes [BR:hpa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     HPAG1_0475
    3.1.1.32  phospholipase A1
     HPAG1_0475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
491138..492205
Genome map
AA seq 355 aa AA seqDB search
MKSILLFMIFVVCQLEGKKFSQDNFKVDYNYYLRKQDLHIIKTQNDLSNAWYLPPQKAPK
EHSWVDFAKKYLNMMDYLGTYFLPFYHSFTPIFQWYHPNINPYQRNEFKFQISFRVPVFR
HILWTKGTLYLAYTQTNWFQIYNDPQSAPMRMINFMPELIYVYPINFKPFGGKIGNFSEI
WIGWQHISNGVGGAQCYQPFNKEGNPENQFPGGPVIVKDYNGQKDVRWGGCRSVSAGQRP
VFRLVWEKGGLKIMVAYWPYVPYDQSNPNLIDYMGYGNAKIDYRRGRHHFELQLYDIFTQ
YWRYDRWHGAFRLGYTYRINPFVGIYAQWFNGYGDGLYEYDVFSNRIGVGIRLNP
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcattttgctctttatgatttttgtagtttgtcagttagaaggcaaaaaattt
tcacaagataattttaaggtggattataactactatttgcgcaaacaggatttgcacatc
attaaaacgcaaaacgatttgtccaatgcctggtatctccctccacaaaaagcccctaaa
gaacattcttgggtggattttgctaaaaaatatttaaacatgatggattatctaggcact
tattttttgcctttttatcatagtttcacccccatttttcaatggtaccaccccaatatc
aacccctatcaacgcaatgagtttaagttccaaattagttttagagtgcctgtatttagg
catattctttggactaaaggcacgctttatttggcttatacccaaactaactggtttcaa
atttataatgacccccaatccgctcccatgcgaatgatcaatttcatgcctgaactcatc
tatgtttatcctattaattttaaaccttttgggggtaagatagggaatttttctgaaatt
tggataggttggcagcacatttctaatggcgtgggaggcgcgcaatgttaccaacctttt
aataaagaaggtaatcctgaaaaccaattcccaggagggcctgtgatcgttaaagattat
aacgggcaaaaagatgtgcgttggggggggtgtcgttcggtgagcgcggggcaacgccct
gtgtttcgtttggtgtgggaaaagggaggtttgaaaatcatggtcgcttattggccctat
gtcccttatgatcaatccaaccctaatttgattgattacatggggtatgggaacgctaaa
attgattacaggagagggcgccaccattttgaattgcaactttatgatattttcacgcaa
tactggcgttatgatcgctggcatggagctttccgcttaggctatacctaccgcattaac
ccttttgtggggatttatgcgcagtggtttaacggctatggcgatggcttgtatgaatac
gatgttttttccaatcgtataggggtaggaatacgcttaaacccttaa

DBGET integrated database retrieval system