KEGG   Helicobacter pylori HPAG1: HPAG1_0631Help
Entry
HPAG1_0631        CDS       T00365                                 

Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hpa  Helicobacter pylori HPAG1
Pathway
hpa00040  Pentose and glucuronate interconversions
hpa00052  Galactose metabolism
hpa00500  Starch and sucrose metabolism
hpa00520  Amino sugar and nucleotide sugar metabolism
hpa01100  Metabolic pathways
hpa01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hpa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HPAG1_0631
   00052 Galactose metabolism
    HPAG1_0631
   00500 Starch and sucrose metabolism
    HPAG1_0631
   00520 Amino sugar and nucleotide sugar metabolism
    HPAG1_0631
Enzymes [BR:hpa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HPAG1_0631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ABF84698
UniProt: Q1CTM4
Structure
PDB: 

Jmol
Position
656737..657558
Genome map
AA seq 273 aa AA seqDB search
MIKKCLFPAAGYGTRFLPITKTIPKEMLPIVDKPLIQYAVEEAMEAGCEVMAIVTGRNKR
SLEDYFDTSYEIEHQIQGTNKENALKSIRNVIEKCCFSYVRQKQMKGLGHAILTGEALIG
NEPFAVILADDLCISHDHPSVLKQMTSLYQKYQCSIVAIEEVALEEVSKYGVIKGEWLEE
GVYEIKDMVEKPSQEDAPSNLAVIGRYILTPDIFEILSETKPGKNNEIQITDALRAQAKR
KRIIAYQFKGKRYDCGSVEGYIEASNAYYKKRL
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaatgcctttttcctgccgctggctacggcacgcgctttttgccgatcact
aaaaccattcctaaagaaatgctgcccattgtggataagcctttaatccaatacgctgtg
gaagaagcgatggaagcaggctgtgaagtgatggcgatcgttacaggcaggaataaacga
agtttagaagattattttgacacgagctatgaaatagagcatcaaatccaaggcaccaac
aaagaaaacgccttaaaaagcattcgtaacgttatagaaaaatgctgtttttcttatgtg
cgccaaaagcaaatgaaaggcttagggcatgcgattttaactggggaagccctgataggc
aatgagccttttgcggtgattttagccgatgacttgtgcataagccatgatcacccaagc
gtgttaaagcaaatgacttcgttgtatcaaaaataccaatgctccattgtagccattgaa
gaagtggcgctagaagaagtttcaaaatacggcgtgattaagggcgaatggttagaagag
ggggtgtatgagattaaagacatggtggaaaaaccaagccaagaagacgctccaagcaat
ctggccgtgatagggcgctacattttaactccggatatttttgaaattttaagcgagacg
aaaccgggtaaaaacaatgaaatccaaatcacggatgccttacgcgctcaagccaaaaga
aaacgcatcatcgcttaccaattcaaaggcaagcgatacgattgcgggagcgtggaaggc
tatattgaagcgagtaacgcttattataaaaaacgcttataa

DBGET integrated database retrieval system