KEGG   Helicobacter pylori HPAG1: HPAG1_1041Help
Entry
HPAG1_1041        CDS       T00365                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
hpa  Helicobacter pylori HPAG1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hpa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HPAG1_1041 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPAG1_1041 (glk)
   00052 Galactose metabolism
    HPAG1_1041 (glk)
   00500 Starch and sucrose metabolism
    HPAG1_1041 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    HPAG1_1041 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HPAG1_1041 (glk)
   00524 Butirosin and neomycin biosynthesis
    HPAG1_1041 (glk)
Enzymes [BR:hpa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HPAG1_1041 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1096073..1097083
Genome map
AA seq 336 aa AA seqDB search
MPKTETYPRLLADIGGTNARFGLEVAPRQIECIEVLRCEDFESLSDAVRFYLSKCKESLK
LHPIYGSFAVATPIMGDFVQMTNNHWTFSIETTRQCLTLKKLLVINDFVAQAYAISAMQE
NDLAQIGGIKCEINAPKAILGPGTGLGVSTLIQNSDGSLKVLPGEGGHVSFAPFDDLEIL
VWQYARSKFNHVSAERFLSGSGLVLIYEALSKRKGLEKVAKLSKAELTPQIISERALNGD
YPICRLTLDTFCSMLGTLAADVALTLGARGGVYLCGGIIPRFIDYFKTSPFRARFETKGR
MGAFLASIPVHVVMKKTPGLDGAGIALENYLLHDKI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaactgaaacttacccaagactattagccgatattggcggcacgaacgcacgc
tttggtttggaagtcgccccacgacagattgaatgcattgaagtcttgcggtgcgaagat
tttgagagcttgagcgatgcggtgcggttttacctttctaaatgcaaagaaagccttaaa
ctgcaccctatttatggctcttttgctgtggctacgcccattatgggggattttgtccaa
atgacgaacaaccattggactttttctattgaaacgacacggcaatgtttgactttaaaa
aaattgcttgtcatcaatgattttgtcgcgcaagcctatgccattagcgcgatgcaagaa
aacgatctggctcaaataggcgggattaagtgcgaaatcaacgctcctaaagcgatttta
gggccaggaaccgggcttggggtaagcactcttatccaaaacagcgatggctctttaaaa
gtcttgcccggtgaaggagggcatgtgagctttgccccttttgacgatctagaaatttta
gtgtggcaatacgcccgctctaaattcaatcatgtgagcgcggaaaggtttttgagcggg
agcggtctggtgctgatttatgaagccctgtctaaacgcaaaggcttagaaaaagtggcg
aagttaagcaaggctgaattaaccccacaaatcattagcgaacgcgctttgaatggggat
taccctatatgccgattgaccttggacactttttgctccatgctaggcacgctcgctgct
gatgtggctctcactttgggggctagggggggcgtgtatttgtgtggggggattatccca
cgattcattgattattttaaaacttcgccctttagagcgcgttttgaaacgaaagggcgc
atgggagcgtttctcgcttctatccctgtgcatgtcgtgatgaaaaaaactccgggactt
gatggggcaggcattgcgttagagaattatttactgcatgataaaatttag

DBGET integrated database retrieval system