KEGG   Helicobacter pylori HPAG1: HPAG1_1041Help
Entry
HPAG1_1041        CDS       T00365                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
hpa  Helicobacter pylori HPAG1
Pathway
hpa00010  Glycolysis / Gluconeogenesis
hpa00052  Galactose metabolism
hpa00500  Starch and sucrose metabolism
hpa00520  Amino sugar and nucleotide sugar metabolism
hpa00521  Streptomycin biosynthesis
hpa01100  Metabolic pathways
hpa01110  Biosynthesis of secondary metabolites
hpa01120  Microbial metabolism in diverse environments
hpa01130  Biosynthesis of antibiotics
hpa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hpa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPAG1_1041
   00052 Galactose metabolism
    HPAG1_1041
   00500 Starch and sucrose metabolism
    HPAG1_1041
   00520 Amino sugar and nucleotide sugar metabolism
    HPAG1_1041
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HPAG1_1041
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    HPAG1_1041
Enzymes [BR:hpa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HPAG1_1041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: ABF85108
UniProt: Q1CSG4
Position
1096073..1097083
Genome map
AA seq 336 aa AA seqDB search
MPKTETYPRLLADIGGTNARFGLEVAPRQIECIEVLRCEDFESLSDAVRFYLSKCKESLK
LHPIYGSFAVATPIMGDFVQMTNNHWTFSIETTRQCLTLKKLLVINDFVAQAYAISAMQE
NDLAQIGGIKCEINAPKAILGPGTGLGVSTLIQNSDGSLKVLPGEGGHVSFAPFDDLEIL
VWQYARSKFNHVSAERFLSGSGLVLIYEALSKRKGLEKVAKLSKAELTPQIISERALNGD
YPICRLTLDTFCSMLGTLAADVALTLGARGGVYLCGGIIPRFIDYFKTSPFRARFETKGR
MGAFLASIPVHVVMKKTPGLDGAGIALENYLLHDKI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaactgaaacttacccaagactattagccgatattggcggcacgaacgcacgc
tttggtttggaagtcgccccacgacagattgaatgcattgaagtcttgcggtgcgaagat
tttgagagcttgagcgatgcggtgcggttttacctttctaaatgcaaagaaagccttaaa
ctgcaccctatttatggctcttttgctgtggctacgcccattatgggggattttgtccaa
atgacgaacaaccattggactttttctattgaaacgacacggcaatgtttgactttaaaa
aaattgcttgtcatcaatgattttgtcgcgcaagcctatgccattagcgcgatgcaagaa
aacgatctggctcaaataggcgggattaagtgcgaaatcaacgctcctaaagcgatttta
gggccaggaaccgggcttggggtaagcactcttatccaaaacagcgatggctctttaaaa
gtcttgcccggtgaaggagggcatgtgagctttgccccttttgacgatctagaaatttta
gtgtggcaatacgcccgctctaaattcaatcatgtgagcgcggaaaggtttttgagcggg
agcggtctggtgctgatttatgaagccctgtctaaacgcaaaggcttagaaaaagtggcg
aagttaagcaaggctgaattaaccccacaaatcattagcgaacgcgctttgaatggggat
taccctatatgccgattgaccttggacactttttgctccatgctaggcacgctcgctgct
gatgtggctctcactttgggggctagggggggcgtgtatttgtgtggggggattatccca
cgattcattgattattttaaaacttcgccctttagagcgcgttttgaaacgaaagggcgc
atgggagcgtttctcgcttctatccctgtgcatgtcgtgatgaaaaaaactccgggactt
gatggggcaggcattgcgttagagaattatttactgcatgataaaatttag

DBGET integrated database retrieval system