KEGG   Helicobacter pylori HPAG1: HPAG1_1048Help
Entry
HPAG1_1048        CDS       T00365                                 

Gene name
porD
Definition
pyruvate flavodoxin oxidoreductase subunit delta (EC:1.2.7.1)
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
hpa  Helicobacter pylori HPAG1
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Class
Metabolism; Overview; Carbon metabolism [PATH:hpa01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hpa00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:hpa00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:hpa00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:hpa00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:hpa00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:hpa00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1103818..1104210
Genome map
AA seq 130 aa AA seqDB search
MKDWNEFEMGAVLFPFEKNAQSEMEKHNDERHYTEQSYFTTSVAHWRVAKPVHNNNICIN
CFNCWVYCPDAAILSREGKLKGVDYSHCKGCGVCVDVCPTNPKSLWMFEEQIEPATALTQ
WPQKQEKKKS
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgaaagattggaatgaatttgaaatgggagcggtgctcttcccttttgaaaaaaacgca
caaagcgaaatggaaaaacacaatgatgagcgccattacaccgaacaaagctacttcacc
acttcagtggctcattggcgcgtggctaagcctgtgcataacaataatatttgcatcaat
tgctttaattgttgggtttattgcccagacgctgccattctttcaagagagggcaaatta
aaaggcgtggattattctcattgtaaaggctgtggcgtgtgcgtggatgtctgccccacc
aaccctaaatcgctatggatgtttgaagaacaaattgagcccgctaccgccctcactcaa
tggccgcaaaaacaagaaaagaaaaaatcataa

DBGET integrated database retrieval system