KEGG   Helicobacter pylori HPAG1: HPAG1_1174Help
Entry
HPAG1_1174        CDS       T00365                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hpa  Helicobacter pylori HPAG1
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hpa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HPAG1_1174
Enzymes [BR:hpa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     HPAG1_1174
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1238158..1239300
Genome map
AA seq 380 aa AA seqDB search
MIVKRLNPDALKNALQKIGPEEIAQNHMHQKGVSFVFEIQHLPLSATLILKQEAISVGGD
FATPRDCILAKEPFYDGVLIVSASQLERLIVKCHSQPFGLKHLAQELKSHLKAKKPNAPQ
IMAILNLTPDSFYEKSRFSSKKALEEIYQLLEKGITLIDIGAASSRPESEIIDPKTEQDR
LKEILLEIKSQKLYQYAKFSIDTYHAKTAQMALEHHFSILNDVSGFNSAEMLEVARDYKP
TCILMHAQKTPKDMQENVFYHNLFDEMDRFFKEKLEVLEKYALQDIILDIGFGFAKLKEH
NLALIKHLSHFLKFKKPLLVGASRKNTIGLITGREVQDRLAGTLSLHLMALQNGASVLRV
HDIDEHIDLIKVFKSLEETD
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgattgtaaaacgccttaaccctgatgcgctcaaaaacgctctacaaaaaataggccca
gaagagattgcgcaaaaccatatgcaccaaaaaggcgttagctttgtttttgaaatccaa
catctgcccttaagcgcaacgctcattttaaagcaagaggccataagcgttgggggcgat
tttgccacgccaagagattgtattttagctaaagagcctttttatgatggggtgttgatt
gtgagcgctagccagttagaacgcctgattgtgaagtgccactcccaaccctttgggctt
aaacatttagcgcaagaattaaaaagccatctcaaagctaaaaaacctaacgccccacag
atcatggcaattttgaatctcacgccggatagcttttatgaaaagagccgttttagtagc
aaaaaagcgcttgaagaaatctatcaattactagaaaagggtatcacgctcattgatata
ggcgcggccagttcaaggccagagagtgaaatcattgatccaaaaacagagcaagatcgc
ttaaaagaaattttattagagatcaaatcccaaaaactctaccaatacgctaaattcagc
atagacacctaccatgccaaaacggcccaaatggctttggaacatcatttttccatcctt
aatgatgtgagcggttttaatagcgctgaaatgctagaagtcgccagagattacaagccc
acttgcattttaatgcatgctcaaaaaacccccaaagacatgcaagaaaatgttttttac
cacaatttatttgatgaaatggatcgcttctttaaggaaaaactagaggttttagaaaaa
tacgcgcttcaagatattattttagatattgggtttggattcgctaaattaaaagagcat
aatttagccttaatcaagcatttaagccactttctcaaattcaaaaaacccttattggtg
ggcgcgagtcgtaaaaacacgatcgggcttatcactgggcgtgaagttcaagaccggctc
gccggcactttgagtttgcatttaatggcgttgcaaaatggagcgagcgttttaagagtg
catgatattgatgagcatatagatttaatcaaagtgtttaagagtttggaagaaacggat
tga

DBGET integrated database retrieval system